Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CREB3L2 Monoclonal Antibody | anti-CREB3L2 antibody

CREB3L2 (BBF2H7, Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, BBF2 Human Homolog on Chromosome 7, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, MGC131709, MGC71006) (MaxLight 550)

Gene Names
CREB3L2; BBF2H7
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CREB3L2; Monoclonal Antibody; CREB3L2 (BBF2H7; Cyclic AMP-responsive Element-binding Protein 3-like Protein 2; BBF2 Human Homolog on Chromosome 7; Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 2; MGC131709; MGC71006) (MaxLight 550); anti-CREB3L2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B8
Specificity
Recognizes human CREB3L2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-CREB3L2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa421-519 from human CREB3L2 (NP_919047) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNT
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CREB3L2 antibody
Transcriptional activator which is processed and activated during endoplasmic reticulum stress late phase. Binds to the cAMP response element (CRE) and activates transcription through CRE. Regulates the transcription of unfolded protein response target genes, preventing accumulation of unfolded proteins in damaged neurons. Also regulates the expression of SEC23A, accelerating protein trafficking from the ER to the Golgi thereby playing a key role in chondrocyte differentiation and formation of epiphyseal cartilage.
Product Categories/Family for anti-CREB3L2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,722 Da
NCBI Official Full Name
cyclic AMP-responsive element-binding protein 3-like protein 2 isoform 1
NCBI Official Synonym Full Names
cAMP responsive element binding protein 3-like 2
NCBI Official Symbol
CREB3L2
NCBI Official Synonym Symbols
BBF2H7
NCBI Protein Information
cyclic AMP-responsive element-binding protein 3-like protein 2

NCBI Description

This gene encodes a member of the oasis bZIP transcription factor family. Members of this family can dimerize but form homodimers only. The encoded protein is a transcriptional activator. Translocations between this gene on chromosome 7 and the gene fused in sarcoma on chromosome 16 can be found in some tumors. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Research Articles on CREB3L2

Similar Products

Product Notes

The CREB3L2 (Catalog #AAA6210955) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CREB3L2 (BBF2H7, Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, BBF2 Human Homolog on Chromosome 7, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, MGC131709, MGC71006) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CREB3L2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CREB3L2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CREB3L2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.