Mouse anti-Human CREB3L2 Monoclonal Antibody | anti-CREB3L2 antibody

CREB3L2 (BBF2H7, Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, BBF2 Human Homolog on Chromosome 7, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, MGC131709, MGC71006) (PE)

Cat. Num. AAA6157257

• Gene Names: CREB3L2; BBF2H7
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CREB3L2; Monoclonal Antibody; CREB3L2 (BBF2H7; Cyclic AMP-responsive Element-binding Protein 3-like Protein 2; BBF2 Human Homolog on Chromosome 7; Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 2; MGC131709; MGC71006) (PE); anti-CREB3L2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B8
• Specificity: Recognizes human CREB3L2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-CREB3L2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa421-519 from human CREB3L2 (NP_919047) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNT
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Testing Data

(Detection limit for recombinant GST tagged CREB3L2 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-CREB3L2 antibody

Transcriptional activator which is processed and activated during endoplasmic reticulum stress late phase. Binds to the cAMP response element (CRE) and activates transcription through CRE. Regulates the transcription of unfolded protein response target genes, preventing accumulation of unfolded proteins in damaged neurons. Also regulates the expression of SEC23A, accelerating protein trafficking from the ER to the Golgi thereby playing a key role in chondrocyte differentiation and formation of epiphyseal cartilage.

Product Categories/Family for anti-CREB3L2 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 56550067
• NCBI GeneID: 64764
• NCBI Accession #: NP_919047.2; NP_001240704.1
• NCBI GenBank Nucleotide #: NM_194071
• Molecular Weight: 27,722 Da
• NCBI Official Full Name: cyclic AMP-responsive element-binding protein 3-like protein 2 isoform 1
• NCBI Official Synonym Full Names: cAMP responsive element binding protein 3-like 2
• NCBI Official Symbol: CREB3L2
• NCBI Official Synonym Symbols: BBF2H7
• NCBI Protein Information: cyclic AMP-responsive element-binding protein 3-like protein 2
• Protein Family: Cyclic AMP-responsive element-binding protein 3-like protein

NCBI Description

This gene encodes a member of the oasis bZIP transcription factor family. Members of this family can dimerize but form homodimers only. The encoded protein is a transcriptional activator. Translocations between this gene on chromosome 7 and the gene fused in sarcoma on chromosome 16 can be found in some tumors. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]