Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse ATP2B4 Monoclonal Antibody | anti-ATP2B4 antibody

ATP2B4 (ATPase, Ca++ Transporting, Plasma Membrane 4, ATP2B2, DKFZp686G08106, DKFZp686M088, MXRA1, PMCA4, PMCA4b, PMCA4x) (MaxLight 490)

Gene Names
ATP2B4; MXRA1; PMCA4; ATP2B2; PMCA4b; PMCA4x
Applications
Western Blot
Purity
Purified
Synonyms
ATP2B4; Monoclonal Antibody; ATP2B4 (ATPase; Ca++ Transporting; Plasma Membrane 4; ATP2B2; DKFZp686G08106; DKFZp686M088; MXRA1; PMCA4; PMCA4b; PMCA4x) (MaxLight 490); ATPase; PMCA4x; anti-ATP2B4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G8
Specificity
Recognizes ATP2B4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
1205
Applicable Applications for anti-ATP2B4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ATP2B4 (NP_001675, 1aa-92aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ATP2B4 antibody
The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 4. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]
Product Categories/Family for anti-ATP2B4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
493
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
plasma membrane calcium-transporting ATPase 4 isoform 4b
NCBI Official Synonym Full Names
ATPase plasma membrane Ca2+ transporting 4
NCBI Official Symbol
ATP2B4
NCBI Official Synonym Symbols
MXRA1; PMCA4; ATP2B2; PMCA4b; PMCA4x
NCBI Protein Information
plasma membrane calcium-transporting ATPase 4
UniProt Protein Name
Plasma membrane calcium-transporting ATPase 4
UniProt Gene Name
ATP2B4
UniProt Synonym Gene Names
PMCA4

NCBI Description

The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 4. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

PMCA4: a plasma membrane calcium pump. A magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell. Eight splice-variant isoforms have been described.

Protein type: Channel, calcium; EC 3.6.3.8; Hydrolase; Membrane protein, integral; Membrane protein, multi-pass; Transporter; Transporter, ion channel

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: basolateral plasma membrane; caveola; integral component of plasma membrane; intracellular membrane-bound organelle; membrane; neuron projection; plasma membrane; protein complex; T-tubule; Z disc

Molecular Function: ATP binding; calcium-transporting ATPase activity; calmodulin binding; metal ion binding; nitric-oxide synthase binding; nitric-oxide synthase inhibitor activity; PDZ domain binding; protein binding; protein kinase binding; protein phosphatase 2B binding; sodium channel regulator activity

Biological Process: calcium ion export; calcium ion import across plasma membrane; cellular calcium ion homeostasis; cellular response to epinephrine stimulus; hippocampus development; negative regulation of adrenergic receptor signaling pathway involved in heart process; negative regulation of arginine catabolic process; negative regulation of nitric oxide biosynthetic process; negative regulation of nitric oxide mediated signal transduction; negative regulation of nitric-oxide synthase activity; negative regulation of peptidyl-cysteine S-nitrosylation; negative regulation of the force of heart contraction; neural retina development; positive regulation of cAMP-dependent protein kinase activity; positive regulation of peptidyl-serine phosphorylation; regulation of cell cycle G1/S phase transition; regulation of sodium ion transmembrane transport; regulation of transcription from RNA polymerase II promoter; response to hydrostatic pressure; sperm motility; spermatogenesis

Research Articles on ATP2B4

Similar Products

Product Notes

The ATP2B4 atp2b4 (Catalog #AAA6205279) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ATP2B4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP2B4 atp2b4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP2B4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.