Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RAB38 Monoclonal Antibody | anti-RAB38 antibody

RAB38 (Ras-related Protein Rab-38, Melanoma Antigen NY-MEL-1) (MaxLight 490)

Gene Names
RAB38; rrGTPbp; NY-MEL-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAB38; Monoclonal Antibody; RAB38 (Ras-related Protein Rab-38; Melanoma Antigen NY-MEL-1) (MaxLight 490); anti-RAB38 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
7F1
Specificity
Recognizes human RAB38.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-RAB38 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa115-212 from RAB38 (NP_071732) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS*
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-RAB38 antibody
May be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.
Product Categories/Family for anti-RAB38 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
ras-related protein Rab-38
NCBI Official Synonym Full Names
RAB38, member RAS oncogene family
NCBI Official Symbol
RAB38
NCBI Official Synonym Symbols
rrGTPbp; NY-MEL-1
NCBI Protein Information
ras-related protein Rab-38
UniProt Protein Name
Ras-related protein Rab-38
Protein Family
UniProt Gene Name
RAB38
UniProt Entry Name
RAB38_HUMAN

Uniprot Description

RAB38: May be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1. Expressed in melanocytes. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein, monomeric, Rab; G protein, monomeric; G protein

Chromosomal Location of Human Ortholog: 11q14

Cellular Component: phagocytic vesicle membrane; membrane; endoplasmic reticulum; early endosome; melanosome; plasma membrane; phagocytic vesicle; trans-Golgi network; cytosol

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; GTP-dependent protein binding

Biological Process: intracellular protein transport; protein transport; platelet dense granule organization and biogenesis; metabolic process; small GTPase mediated signal transduction; Rab protein signal transduction

Research Articles on RAB38

Similar Products

Product Notes

The RAB38 rab38 (Catalog #AAA6202803) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAB38 (Ras-related Protein Rab-38, Melanoma Antigen NY-MEL-1) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB38 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB38 rab38 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB38, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.