Mouse anti-Human SLC25A20 Monoclonal Antibody | anti-SLC25A20 antibody

SLC25A20 (Mitochondrial Carnitine/Acylcarnitine Carrier Protein, Carnitine/Acylcarnitine Translocase, CAC, Solute Carrier Family 25 Member 20, CAC, CACT) (PE)

Cat. Num. AAA6160316

• Gene Names: SLC25A20; CAC; CACT
• Reactivity: Human
• Applications: ELISA, Immunofluorescence
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SLC25A20; Monoclonal Antibody; SLC25A20 (Mitochondrial Carnitine/Acylcarnitine Carrier Protein; Carnitine/Acylcarnitine Translocase; CAC; Solute Carrier Family 25 Member 20; CACT) (PE); anti-SLC25A20 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: M2
• Specificity: Recognizes human SLC25A20.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-SLC25A20 antibody: ELISA (EIA), Immunofluorescence (IF)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-301 from human SLC25A20 (AAH01689) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MADQPKPISPLKNLLAGGFGGVCLVFAGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SLC25A20 on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-SLC25A20 antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 33876415
• NCBI GeneID: 788
• Molecular Weight: 32,944 Da
• NCBI Official Full Name: Homo sapiens solute carrier family 25 (carnitine/acylcarnitine translocase), member 20, mRNA
• NCBI Official Synonym Full Names: solute carrier family 25 member 20
• NCBI Official Symbol: SLC25A20
• NCBI Official Synonym Symbols: CAC; CACT
• NCBI Protein Information: mitochondrial carnitine/acylcarnitine carrier protein
• Protein Family: Mitochondrial carnitine/acylcarnitine carrier protein

NCBI Description

This gene product is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space. This protein mediates the transport of acylcarnitines into mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. Mutations in this gene are associated with carnitine-acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants. [provided by RefSeq, Jul 2008]