Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human FABP6 Monoclonal Antibody | anti-FABP6 antibody

FABP6 (Intestinal Bile Acid-binding Protein, I-BABP, Intestinal 15kD Protein, I-15P, Ileal Lipid-binding Protein, ILBP, Fatty Acid-binding Protein 6, Gastrotropin, GT, ILBP, ILLBP) (MaxLight 490)

Gene Names
FABP6; ILBP; I-15P; I-BAP; ILBP3; ILLBP; I-BABP; I-BALB
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FABP6; Monoclonal Antibody; FABP6 (Intestinal Bile Acid-binding Protein; I-BABP; Intestinal 15kD Protein; I-15P; Ileal Lipid-binding Protein; ILBP; Fatty Acid-binding Protein 6; Gastrotropin; GT; ILLBP) (MaxLight 490); anti-FABP6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A4
Specificity
Recognizes human FABP6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-FABP6 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-128 from human FABP6 (AAH22489) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-FABP6 antibody
FABP6 is the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.
Product Categories/Family for anti-FABP6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
19,874 Da
NCBI Official Full Name
Homo sapiens fatty acid binding protein 6, ileal, mRNA
NCBI Official Synonym Full Names
fatty acid binding protein 6
NCBI Official Symbol
FABP6
NCBI Official Synonym Symbols
ILBP; I-15P; I-BAP; ILBP3; ILLBP; I-BABP; I-BALB
NCBI Protein Information
gastrotropin
Protein Family

NCBI Description

This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on FABP6

Similar Products

Product Notes

The FABP6 (Catalog #AAA6200754) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FABP6 (Intestinal Bile Acid-binding Protein, I-BABP, Intestinal 15kD Protein, I-15P, Ileal Lipid-binding Protein, ILBP, Fatty Acid-binding Protein 6, Gastrotropin, GT, ILBP, ILLBP) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FABP6 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FABP6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FABP6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.