Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Rat WIPI1 Monoclonal Antibody | anti-WIPI1 antibody

WIPI1 (WD Repeat Domain Phosphoinositide-interacting Protein 1, WIPI-1, Atg18 Protein Homolog, WD40 Repeat Protein Interacting with Phosphoinositides of 49kD, WIPI 49kD, WIPI49) (MaxLight 405)

Gene Names
WIPI1; ATG18; ATG18A; WIPI49
Reactivity
Human, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WIPI1; Monoclonal Antibody; WIPI1 (WD Repeat Domain Phosphoinositide-interacting Protein 1; WIPI-1; Atg18 Protein Homolog; WD40 Repeat Protein Interacting with Phosphoinositides of 49kD; WIPI 49kD; WIPI49) (MaxLight 405); anti-WIPI1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C1
Specificity
Recognizes human WIPI1. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-WIPI1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa348-446 from human WIPI1 (NP_060453) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQ
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-WIPI1 antibody
MaxLight405 is a new Violet photostable dye conjugate comparable to Alexa Fluor 405, PacificBlue, Brilliant Violet 421 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (400nm); Emission (423nm); Extinction Coefficient 32,000.
Product Categories/Family for anti-WIPI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
WD repeat domain phosphoinositide-interacting protein 1
NCBI Official Synonym Full Names
WD repeat domain, phosphoinositide interacting 1
NCBI Official Symbol
WIPI1
NCBI Official Synonym Symbols
ATG18; ATG18A; WIPI49
NCBI Protein Information
WD repeat domain phosphoinositide-interacting protein 1; WIPI 49 kDa; WIPI-1 alpha; atg18 protein homolog; WD40 repeat protein Interacting with phosphoInositides of 49kDa; WD40 repeat protein interacting with phosphoinositides of 49 kDa
UniProt Protein Name
WD repeat domain phosphoinositide-interacting protein 1
UniProt Gene Name
WIPI1
UniProt Synonym Gene Names
WIPI49; WIPI-1; WIPI 49 kDa
UniProt Entry Name
WIPI1_HUMAN

NCBI Description

WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI1, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids (Proikas-Cezanne et al., 2004 [PubMed 15602573]).[supplied by OMIM, Mar 2008]

Uniprot Description

ATG18: May play a role in autophagy. May regulate the trafficking of proteins involved in the mannose-6-phosphate receptor (MPR) recycling pathway. Probably interacts with androgen (AR) and the estrogen receptor (ER). Binds PtdIns3P and to a lesser extent, PtdIns3,5P2 and PtdIns5P in vitro. Interaction with PtdIns3P is required for recruitment to membranes. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Autophagy

Chromosomal Location of Human Ortholog: 17q24.2

Cellular Component: Golgi membrane; cytoskeleton; extrinsic to membrane; clathrin-coated vesicle; pre-autophagosomal structure membrane; cytoplasm; endosome membrane; trans-Golgi network; cytosol

Molecular Function: androgen receptor binding; estrogen receptor binding; phosphatidylinositol 3-phosphate binding; receptor binding

Biological Process: cellular protein metabolic process; unfolded protein response, activation of signaling protein activity; unfolded protein response; protein amino acid lipidation; mitochondrion degradation; autophagy; autophagic vacuole formation; cellular response to nitrogen starvation; vesicle targeting, trans-Golgi to endosome

Research Articles on WIPI1

Similar Products

Product Notes

The WIPI1 wipi1 (Catalog #AAA6193435) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WIPI1 (WD Repeat Domain Phosphoinositide-interacting Protein 1, WIPI-1, Atg18 Protein Homolog, WD40 Repeat Protein Interacting with Phosphoinositides of 49kD, WIPI 49kD, WIPI49) (MaxLight 405) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WIPI1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WIPI1 wipi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WIPI1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.