Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RGS4 Monoclonal Antibody | anti-RGS4 antibody

RGS4 (Regulator of G-Protein Signaling 4, Regulator of G-Protein Signalling 4, RGS-4, MGC2124, MGC60244, RGP4, SCZD9) (MaxLight 405)

Gene Names
RGS4; RGP4; SCZD9
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RGS4; Monoclonal Antibody; RGS4 (Regulator of G-Protein Signaling 4; Regulator of G-Protein Signalling 4; RGS-4; MGC2124; MGC60244; RGP4; SCZD9) (MaxLight 405); anti-RGS4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B2
Specificity
Recognizes human RGS4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-RGS4 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to human RGS4, aa1-206 (AAH51869) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-RGS4 antibody
RGS signaling proteins are highly diverse and multifunctional proteins acting as inhibitors of G-protein signaling. They function as GTPase activating proteins (GAPs) for G-alpha sub-units of heterotrimeric G proteins and drive G proteins into their inactive GDP-bound forms. RGS4 is a member of B/R4 sub-family of these proteins and consists of a highly conserved RGS domain. It plays a crucial role in regulating G-protein signaling, IP3-mediated Ca2+ signaling and relaxation of G-protein gated potassium channels. Located both in the cytosol and membrane-bound, it acts as a multifunctional scaffold protein and blocks G i/o-mediated signaling in mammalian cells. RGS4 selectively binds to PIP3 and blocks Gq/11-directed inositol lipid/Ca2+ signaling. It is regulated by post-translational modifications which include palmitoylation and phosphorylation of RGS domain. Role of RGS4 has been implicated in Schizophrenia and chronic heart failure.
Product Categories/Family for anti-RGS4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated Molecular Weight: 23kDa
Observed Molecular Weight: 34kDa
NCBI Official Full Name
Homo sapiens regulator of G-protein signaling 4, mRNA
NCBI Official Synonym Full Names
regulator of G protein signaling 4
NCBI Official Symbol
RGS4
NCBI Official Synonym Symbols
RGP4; SCZD9
NCBI Protein Information
regulator of G-protein signaling 4
UniProt Protein Name
Regulator of G-protein signaling 4
UniProt Gene Name
RGS4
UniProt Synonym Gene Names
RGP4; RGS4
UniProt Entry Name
RGS4_HUMAN

NCBI Description

Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. Regulator of G protein signaling 4 protein is 37% identical to RGS1 and 97% identical to rat Rgs4. This protein negatively regulate signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

RGS4: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(z)-alpha is inhibited by phosphorylation of the G-protein. Activity on G(z)-alpha and G(i)-alpha-1 is inhibited by palmitoylation of the G-protein. Expressed in brain and heart. Expressed in brain at protein level. Expressed in prefontal and visual cortex. Isoform 4 and isoform 5 are expressed ubiquitously. Isoform 1, isoform 2 and isoform 3 are not expressed in the cerebellum. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs, RGS; GAPs

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: protein complex; cytoplasm; plasma membrane; cytosol

Molecular Function: calmodulin binding; G-protein alpha-subunit binding; GTPase activator activity

Biological Process: regulation of G-protein coupled receptor protein signaling pathway; positive regulation of GTPase activity; inactivation of MAPK activity

Disease: Schizophrenia 9

Research Articles on RGS4

Similar Products

Product Notes

The RGS4 rgs4 (Catalog #AAA6192275) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RGS4 (Regulator of G-Protein Signaling 4, Regulator of G-Protein Signalling 4, RGS-4, MGC2124, MGC60244, RGP4, SCZD9) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RGS4 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RGS4 rgs4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RGS4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.