Mouse anti-Human RGS4 Monoclonal Antibody | anti-RGS4 antibody

RGS4 (Regulator of G-Protein Signaling 4, Regulator of G-Protein Signalling 4, RGS-4, MGC2124, MGC60244, RGP4, SCZD9) APC

Cat. Num. AAA6138714

• Gene Names: RGS4; RGP4; SCZD9
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RGS4; Monoclonal Antibody; RGS4 (Regulator of G-Protein Signaling 4; Regulator of G-Protein Signalling 4; RGS-4; MGC2124; MGC60244; RGP4; SCZD9) APC; anti-RGS4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2B2
• Specificity: Recognizes human RGS4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-RGS4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to human RGS4, aa1-206 (AAH51869) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RGS4 expression in transfected 293T cell line by RGS4 monoclonal antibody. Lane 1: RGS4 transfected lysate (23.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RGS4 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-RGS4 antibody

RGS signaling proteins are highly diverse and multifunctional proteins acting as inhibitors of G-protein signaling. They function as GTPase activating proteins (GAPs) for G-alpha sub-units of heterotrimeric G proteins and drive G proteins into their inactive GDP-bound forms. RGS4 is a member of B/R4 sub-family of these proteins and consists of a highly conserved RGS domain. It plays a crucial role in regulating G-protein signaling, IP3-mediated Ca2+ signaling and relaxation of G-protein gated potassium channels. Located both in the cytosol and membrane-bound, it acts as a multifunctional scaffold protein and blocks G i/o-mediated signaling in mammalian cells. RGS4 selectively binds to PIP3 and blocks Gq/11-directed inositol lipid/Ca2+ signaling. It is regulated by post-translational modifications which include palmitoylation and phosphorylation of RGS domain. Role of RGS4 has been implicated in Schizophrenia and chronic heart failure.

Product Categories/Family for anti-RGS4 antibody

Antibodies; G Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 30354011
• NCBI GeneID: 5999
• UniProt Accession #: P49798; A7XA56; A7XA58; A7XA59; A7YVV7; B1APZ3
• Molecular Weight: Calculated Molecular Weight: 23kDa; Observed Molecular Weight: 34kDa
• NCBI Official Full Name: Homo sapiens regulator of G-protein signaling 4, mRNA
• NCBI Official Synonym Full Names: regulator of G protein signaling 4
• NCBI Official Symbol: RGS4
• NCBI Official Synonym Symbols: RGP4; SCZD9
• NCBI Protein Information: regulator of G-protein signaling 4
• UniProt Protein Name: Regulator of G-protein signaling 4
• Protein Family: Regulator of G-protein signaling
• UniProt Gene Name: RGS4
• UniProt Synonym Gene Names: RGP4; RGS4
• UniProt Entry Name: RGS4_HUMAN

NCBI Description

Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. Regulator of G protein signaling 4 protein is 37% identical to RGS1 and 97% identical to rat Rgs4. This protein negatively regulate signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

RGS4: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(z)-alpha is inhibited by phosphorylation of the G-protein. Activity on G(z)-alpha and G(i)-alpha-1 is inhibited by palmitoylation of the G-protein. Expressed in brain and heart. Expressed in brain at protein level. Expressed in prefontal and visual cortex. Isoform 4 and isoform 5 are expressed ubiquitously. Isoform 1, isoform 2 and isoform 3 are not expressed in the cerebellum. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs, RGS; GAPs

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: protein complex; cytoplasm; plasma membrane; cytosol

Molecular Function: calmodulin binding; G-protein alpha-subunit binding; GTPase activator activity

Biological Process: regulation of G-protein coupled receptor protein signaling pathway; positive regulation of GTPase activity; inactivation of MAPK activity

Disease: Schizophrenia 9