Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DPYSL2 Monoclonal Antibody | anti-DPYSL2 antibody

DPYSL2 (Dihydropyrimidinase-related Protein 2, DRP-2, Collapsin Response Mediator Protein 2, CRMP-2, N2A3, Unc-33-like Phosphoprotein 2, ULIP-2, CRMP2, ULIP2) (MaxLight 405)

Gene Names
DPYSL2; DRP2; N2A3; CRMP2; DRP-2; ULIP2; CRMP-2; DHPRP2; ULIP-2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DPYSL2; Monoclonal Antibody; DPYSL2 (Dihydropyrimidinase-related Protein 2; DRP-2; Collapsin Response Mediator Protein 2; CRMP-2; N2A3; Unc-33-like Phosphoprotein 2; ULIP-2; CRMP2; ULIP2) (MaxLight 405); anti-DPYSL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F11
Specificity
Recognizes human DPYSL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-DPYSL2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa470-571 from human DPYSL2 (NP_001377.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSL
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DPYSL2 antibody
CRMP2 also regulates axon formation and branching by binding tubulin heterodimers thereby enhancing microtubule polymerisation. Through its interaction with ROKalpha, CRMP2 is also thought to play a role in RhoA-dependent signalling. CRMP2 is associated with mesial temporal lobe epilepsy and schizophrenia.
Product Categories/Family for anti-DPYSL2 antibody
References
1. Quantitative Proteome Analysis of Pluripotent Cells by iTRAQ Mass Tagging Reveals Post-transcriptional Regulation of Proteins Required for ES Cell Self-renewal O'Brien RN, Shen Z, Tachikawa K, Lee PA, Briggs SP.Mol Cell Proteomics. 2010 Oct;9(10):2238-51. Epub 2010 May 31.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,163 Da
NCBI Official Full Name
dihydropyrimidinase-related protein 2 isoform 2
NCBI Official Synonym Full Names
dihydropyrimidinase-like 2
NCBI Official Symbol
DPYSL2
NCBI Official Synonym Symbols
DRP2; N2A3; CRMP2; DRP-2; ULIP2; CRMP-2; DHPRP2; ULIP-2
NCBI Protein Information
dihydropyrimidinase-related protein 2; unc-33-like phosphoprotein 2; collapsin response mediator protein hCRMP-2
UniProt Protein Name
Dihydropyrimidinase-related protein 2
UniProt Gene Name
DPYSL2
UniProt Synonym Gene Names
CRMP2; ULIP2; DRP-2; CRMP-2; ULIP-2
UniProt Entry Name
DPYL2_HUMAN

NCBI Description

This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

CRMP-2: a microtubule-binding protein necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration. Homotetramer, and heterotetramer with CRMP1, CRMP-3, CRMP-4, or CRMP-5. Interacts through its C-terminus with the C-terminus of CYFIP1. Interacts with 5-hydroxytryptamine receptor 4 (5-HT(4)).

Protein type: Motility/polarity/chemotaxis; Microtubule-binding

Chromosomal Location of Human Ortholog: 8p22-p21

Cellular Component: microtubule; growth cone; cell soma; membrane; mitochondrion; dendrite; terminal button; cytosol

Molecular Function: protein binding; dihydropyrimidinase activity; protein kinase binding

Biological Process: response to drug; nervous system development; axon guidance; olfactory bulb development; response to amphetamine; synaptic vesicle transport; positive regulation of glutamate secretion; endocytosis; cytoskeleton organization and biogenesis; response to cocaine; signal transduction; pyrimidine base catabolic process; spinal cord development; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process

Research Articles on DPYSL2

Similar Products

Product Notes

The DPYSL2 dpysl2 (Catalog #AAA6189860) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DPYSL2 (Dihydropyrimidinase-related Protein 2, DRP-2, Collapsin Response Mediator Protein 2, CRMP-2, N2A3, Unc-33-like Phosphoprotein 2, ULIP-2, CRMP2, ULIP2) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DPYSL2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DPYSL2 dpysl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DPYSL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.