Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ATF6B Monoclonal Antibody | anti-ATF6B antibody

ATF6B (Cyclic AMP-dependent Transcription Factor ATF-6 beta, cAMP-dependent Transcription Factor ATF-6 beta, Activating Transcription Factor 6 beta, ATF6-beta, Protein G13, cAMP Response Element-binding Protein-related Protein, Creb-rp, cAMP-responsive El

Gene Names
ATF6B; G13; CREBL1; CREB-RP
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATF6B; Monoclonal Antibody; ATF6B (Cyclic AMP-dependent Transcription Factor ATF-6 beta; cAMP-dependent Transcription Factor ATF-6 beta; Activating Transcription Factor 6 beta; ATF6-beta; Protein G13; cAMP Response Element-binding Protein-related Protein; Creb-rp; cAMP-responsive El; anti-ATF6B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D10
Specificity
Recognizes human CREBL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-ATF6B antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-88 from human CREBL1 (NP_004372.3) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ATF6B antibody
Transcriptional factor that acts in the unfolded protein response (UPR) pathway by activating UPR target genes induced during ER stress. Binds DNA on the 5'-CCAC[GA]-3' half of the ER stress response element (ERSE) (5'-CCAATN9CCAC[GA]-3') when NF-Y is bound to ERSE.
Product Categories/Family for anti-ATF6B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
76,412 Da
NCBI Official Full Name
cyclic AMP-dependent transcription factor ATF-6 beta isoform a
NCBI Official Synonym Full Names
activating transcription factor 6 beta
NCBI Official Symbol
ATF6B
NCBI Official Synonym Symbols
G13; CREBL1; CREB-RP
NCBI Protein Information
cyclic AMP-dependent transcription factor ATF-6 beta; protein G13; Creb-related protein; cAMP responsive element binding protein-like 1; cAMP-dependent transcription factor ATF-6 beta; cAMP-responsive element-binding protein-like 1; cAMP response element-

NCBI Description

The protein encoded by this gene is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the encoded protein binds to the ER stress response element, interacting with nuclear transcription factor Y to activate UPR target genes. The protein is normally found in the membrane of the endoplasmic reticulum; however, under ER stress, the N-terminal cytoplasmic domain is cleaved from the rest of the protein and translocates to the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]

Research Articles on ATF6B

Similar Products

Product Notes

The ATF6B (Catalog #AAA6188975) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATF6B (Cyclic AMP-dependent Transcription Factor ATF-6 beta, cAMP-dependent Transcription Factor ATF-6 beta, Activating Transcription Factor 6 beta, ATF6-beta, Protein G13, cAMP Response Element-binding Protein-related Protein, Creb-rp, cAMP-responsive El reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATF6B can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATF6B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATF6B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.