Mouse LHX1 Monoclonal Antibody | anti-LHX1 antibody

LHX1 (LIM Homeobox 1, LIM-1, LIM1, MGC126723, MGC138141) (PE)

Cat. Num. AAA6185249

• Gene Names: LHX1; LIM1; LIM-1
• Applications: ELISA, Immunohistochemistry
• Purity: Purified
• Synonyms: LHX1; Monoclonal Antibody; LHX1 (LIM Homeobox 1; LIM-1; LIM1; MGC126723; MGC138141) (PE); LIM Homeobox 1; MGC138141; anti-LHX1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2G10
• Specificity: Recognizes LHX1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-LHX1 antibody: ELISA (EIA), Immunohistochemistry (IHC)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: LHX1 (NP_005559, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLST
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to LHX1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LHX1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml])

Related Product Information for anti-LHX1 antibody

This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in control of differentiation and development of neural and lymphoid cells. A similar protein in mice is an essential regulator of the vertebrate head organizer. [provided by RefSeq]

Product Categories/Family for anti-LHX1 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 30410785
• NCBI GeneID: 3975
• NCBI Accession #: NP_005559
• NCBI GenBank Nucleotide #: NM_005568
• UniProt Accession #: P48742
• Molecular Weight: 45kDa
• NCBI Official Full Name: LIM/homeobox protein Lhx1
• NCBI Official Synonym Full Names: LIM homeobox 1
• NCBI Official Symbol: LHX1
• NCBI Official Synonym Symbols: LIM1; LIM-1
• NCBI Protein Information: LIM/homeobox protein Lhx1
• UniProt Protein Name: LIM/homeobox protein Lhx1
• UniProt Gene Name: LHX1
• UniProt Synonym Gene Names: LIM-1; LIM1; LIM homeobox protein 1; hLim-1
• UniProt Entry Name: LHX1_HUMAN

NCBI Description

This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor important for the development of the renal and urogenital systems. This gene is a candidate for Mayer-Rokitansky-Kuster-Hauser syndrome, a disorder characterized by anomalies in the female genital tract. [provided by RefSeq, Dec 2010]

Uniprot Description

LHX1: Potential transcription factor. May play a role in early mesoderm formation and later in lateral mesoderm differentiation and neurogenesis.

Protein type: Transcription factor; Cell development/differentiation

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: protein complex; nucleus

Molecular Function: zinc ion binding; sequence-specific DNA binding; transcription corepressor activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; motor axon guidance; uterus development; forebrain regionalization; embryonic pattern specification; pronephros development; post-embryonic development; anterior/posterior pattern formation; cell-cell signaling; ectoderm formation; ureteric bud development; anatomical structure formation; cerebellum development; kidney development; fallopian tube development; cervix development; nervous system development; anatomical structure morphogenesis; vagina development; ventral spinal cord development; gastrulation with mouth forming second; embryonic viscerocranium morphogenesis; somite rostral/caudal axis specification; pattern specification process; Purkinje cell-granule cell precursor cell signaling involved in regulation of granule cell precursor cell proliferation; organ morphogenesis; telencephalon development; positive regulation of embryonic development; dorsal/ventral pattern formation; regulation of gene expression; endoderm formation; ureteric bud branching; embryonic retina morphogenesis in camera-type eye; cerebellar Purkinje cell differentiation; spinal cord association neuron differentiation; negative regulation of transcription, DNA-dependent; urogenital system development; anterior/posterior axis specification