Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to LHX1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml])

Mouse LHX1 Monoclonal Antibody | anti-LHX1 antibody

LHX1 (LIM Homeobox 1, LIM-1, LIM1, MGC126723, MGC138141) (APC)

Gene Names
LHX1; LIM1; LIM-1
Applications
ELISA, Immunohistochemistry
Purity
Purified
Synonyms
LHX1; Monoclonal Antibody; LHX1 (LIM Homeobox 1; LIM-1; LIM1; MGC126723; MGC138141) (APC); LIM Homeobox 1; MGC138141; anti-LHX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2G10
Specificity
Recognizes LHX1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-LHX1 antibody
ELISA (EIA), Immunohistochemistry (IHC)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
LHX1 (NP_005559, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLST
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to LHX1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to LHX1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LHX1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to LHX1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml])
Related Product Information for anti-LHX1 antibody
This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in control of differentiation and development of neural and lymphoid cells. A similar protein in mice is an essential regulator of the vertebrate head organizer. [provided by RefSeq]
Product Categories/Family for anti-LHX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
LIM/homeobox protein Lhx1
NCBI Official Synonym Full Names
LIM homeobox 1
NCBI Official Symbol
LHX1
NCBI Official Synonym Symbols
LIM1; LIM-1
NCBI Protein Information
LIM/homeobox protein Lhx1
UniProt Protein Name
LIM/homeobox protein Lhx1
UniProt Gene Name
LHX1
UniProt Synonym Gene Names
LIM-1; LIM1; LIM homeobox protein 1; hLim-1
UniProt Entry Name
LHX1_HUMAN

NCBI Description

This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor important for the development of the renal and urogenital systems. This gene is a candidate for Mayer-Rokitansky-Kuster-Hauser syndrome, a disorder characterized by anomalies in the female genital tract. [provided by RefSeq, Dec 2010]

Uniprot Description

LHX1: Potential transcription factor. May play a role in early mesoderm formation and later in lateral mesoderm differentiation and neurogenesis.

Protein type: Transcription factor; Cell development/differentiation

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: protein complex; nucleus

Molecular Function: zinc ion binding; sequence-specific DNA binding; transcription corepressor activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; motor axon guidance; uterus development; forebrain regionalization; embryonic pattern specification; pronephros development; post-embryonic development; anterior/posterior pattern formation; cell-cell signaling; ectoderm formation; ureteric bud development; anatomical structure formation; cerebellum development; kidney development; fallopian tube development; cervix development; nervous system development; anatomical structure morphogenesis; vagina development; ventral spinal cord development; gastrulation with mouth forming second; embryonic viscerocranium morphogenesis; somite rostral/caudal axis specification; pattern specification process; Purkinje cell-granule cell precursor cell signaling involved in regulation of granule cell precursor cell proliferation; organ morphogenesis; telencephalon development; positive regulation of embryonic development; dorsal/ventral pattern formation; regulation of gene expression; endoderm formation; ureteric bud branching; embryonic retina morphogenesis in camera-type eye; cerebellar Purkinje cell differentiation; spinal cord association neuron differentiation; negative regulation of transcription, DNA-dependent; urogenital system development; anterior/posterior axis specification

Research Articles on LHX1

Similar Products

Product Notes

The LHX1 lhx1 (Catalog #AAA6167609) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LHX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LHX1 lhx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LHX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.