Mouse LHX1 Monoclonal Antibody | anti-LHX1 antibody

LHX1 (LIM Homeobox 1, LIM-1, LIM1, MGC126723, MGC138141) (AP)

Cat. Num. AAA6163199

• Gene Names: LHX1; LIM1; LIM-1
• Applications: ELISA, Immunohistochemistry
• Purity: Purified
• Synonyms: LHX1; Monoclonal Antibody; LHX1 (LIM Homeobox 1; LIM-1; LIM1; MGC126723; MGC138141) (AP); LIM Homeobox 1; MGC138141; anti-LHX1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2G10
• Specificity: Recognizes LHX1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-LHX1 antibody: ELISA (EIA), Immunohistochemistry (IHC)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: LHX1 (NP_005559, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLST
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to LHX1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LHX1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml])

Related Product Information for anti-LHX1 antibody

This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in control of differentiation and development of neural and lymphoid cells. A similar protein in mice is an essential regulator of the vertebrate head organizer. [provided by RefSeq]

Product Categories/Family for anti-LHX1 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 30410785
• NCBI GeneID: 3975
• NCBI Accession #: NP_005559
• NCBI GenBank Nucleotide #: NM_005568
• UniProt Accession #: P48742
• Molecular Weight: 45kDa
• NCBI Official Full Name: LIM/homeobox protein Lhx1
• NCBI Official Synonym Full Names: LIM homeobox 1
• NCBI Official Symbol: LHX1
• NCBI Official Synonym Symbols: LIM1; LIM-1
• NCBI Protein Information: LIM/homeobox protein Lhx1
• UniProt Protein Name: LIM/homeobox protein Lhx1
• UniProt Gene Name: LHX1
• UniProt Synonym Gene Names: LIM-1; LIM1; LIM homeobox protein 1; hLim-1
• UniProt Entry Name: LHX1_HUMAN

NCBI Description

This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor important for the development of the renal and urogenital systems. This gene is a candidate for Mayer-Rokitansky-Kuster-Hauser syndrome, a disorder characterized by anomalies in the female genital tract. [provided by RefSeq, Dec 2010]

Uniprot Description

LHX1: Potential transcription factor. May play a role in early mesoderm formation and later in lateral mesoderm differentiation and neurogenesis.

Protein type: Transcription factor; Cell development/differentiation

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: protein complex; nucleus

Molecular Function: zinc ion binding; sequence-specific DNA binding; transcription corepressor activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; motor axon guidance; uterus development; forebrain regionalization; embryonic pattern specification; pronephros development; post-embryonic development; anterior/posterior pattern formation; cell-cell signaling; ectoderm formation; ureteric bud development; anatomical structure formation; cerebellum development; kidney development; fallopian tube development; cervix development; nervous system development; anatomical structure morphogenesis; vagina development; ventral spinal cord development; gastrulation with mouth forming second; embryonic viscerocranium morphogenesis; somite rostral/caudal axis specification; pattern specification process; Purkinje cell-granule cell precursor cell signaling involved in regulation of granule cell precursor cell proliferation; organ morphogenesis; telencephalon development; positive regulation of embryonic development; dorsal/ventral pattern formation; regulation of gene expression; endoderm formation; ureteric bud branching; embryonic retina morphogenesis in camera-type eye; cerebellar Purkinje cell differentiation; spinal cord association neuron differentiation; negative regulation of transcription, DNA-dependent; urogenital system development; anterior/posterior axis specification