Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MTA3 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse MTA3 Monoclonal Antibody | anti-MTA3 antibody

MTA3 (Metastasis Associated 1 Family, Member 3, KIAA1266) (PE)

Applications
ELISA, Immunofluorescence
Purity
Purified
Synonyms
MTA3; Monoclonal Antibody; MTA3 (Metastasis Associated 1 Family; Member 3; KIAA1266) (PE); Metastasis Associated 1 Family; KIAA1266; anti-MTA3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B3
Specificity
Recognizes MTA3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MTA3 antibody
ELISA (EIA), Immunofluorescence (IF)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MTA3 (NP_065795, 416aa-515aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LKMPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTLRLRQAARRPFVAINYAAIRAECKMLLNS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MTA3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MTA3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MTA3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MTA3 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-MTA3 antibody
Mouse monoclonal antibody raised against a partial recombinant MTA3.
Product Categories/Family for anti-MTA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,814 Da
NCBI Official Full Name
metastasis-associated protein MTA3 isoform b
NCBI Official Synonym Full Names
metastasis associated 1 family, member 3
NCBI Official Symbol
MTA3
NCBI Protein Information
metastasis-associated protein MTA3; metastasis associated family, member 3; metastasis associated gene family, member 3
UniProt Protein Name
Metastasis-associated protein MTA3
UniProt Gene Name
MTA3
UniProt Synonym Gene Names
KIAA1266
UniProt Entry Name
MTA3_HUMAN

Uniprot Description

MTA3: Plays a role in maintenance of the normal epithelial architecture through the repression of SNAI1 transcription in a histone deacetylase-dependent manner, and thus the regulation of E-cadherin levels. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 2p21

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; nucleus

Molecular Function: protein binding; zinc ion binding; sequence-specific DNA binding; chromatin binding; transcription factor activity

Biological Process: establishment and/or maintenance of chromatin architecture; regulation of transcription, DNA-dependent

Similar Products

Product Notes

The MTA3 mta3 (Catalog #AAA6184976) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MTA3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MTA3 mta3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MTA3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.