Mouse U2AF2 Monoclonal Antibody | anti-U2AF2 antibody

U2AF2 (U2 Small Nuclear RNA Auxiliary Factor 2, U2AF65) (HRP)

Cat. Num. AAA6183189

• Gene Names: U2AF2; U2AF65
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: U2AF2; Monoclonal Antibody; U2AF2 (U2 Small Nuclear RNA Auxiliary Factor 2; U2AF65) (HRP); U2 Small Nuclear RNA Auxiliary Factor 2; U2AF65; anti-U2AF2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5G8
• Specificity: Recognizes U2AF2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-U2AF2 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: U2AF2 (NP_001012496.1, 141aa-240aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(U2AF2 monoclonal antibody (M03), clone 5G8. Western Blot analysis of U2AF2 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged U2AF2 is 0.3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to U2AF2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to U2AF2 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-U2AF2 antibody

Antibodies; Splicing Factors

NCBI and Uniprot Product Information

• NCBI GI #: 60279268
• NCBI GeneID: 11338
• NCBI Accession #: NP_001012496.1
• NCBI GenBank Nucleotide #: NM_001012478.1
• UniProt Accession #: P26368; Q96HC5
• Molecular Weight: 53,501 Da
• NCBI Official Full Name: splicing factor U2AF 65 kDa subunit isoform b
• NCBI Official Synonym Full Names: U2 small nuclear RNA auxiliary factor 2
• NCBI Official Symbol: U2AF2
• NCBI Official Synonym Symbols: U2AF65
• NCBI Protein Information: splicing factor U2AF 65 kDa subunit; hU2AF65; U2 auxiliary factor 65 kDa subunit; U2 snRNP auxiliary factor large subunit; U2 (RNU2) small nuclear RNA auxiliary factor 2; U2 small nuclear ribonucleoprotein auxiliary factor (65kD)
• UniProt Protein Name: Splicing factor U2AF 65 kDa subunit
• Protein Family: Splicing factor
• UniProt Gene Name: U2AF2
• UniProt Synonym Gene Names: U2AF65; hU2AF(65); hU2AF65
• UniProt Entry Name: U2AF2_HUMAN

Uniprot Description

U2AF2: Necessary for the splicing of pre-mRNA. Induces cardiac troponin-T (TNNT2) pre-mRNA exon inclusion in muscle. Regulates the TNNT2 exon 5 inclusion through competition with MBNL1. Binds preferentially to a single-stranded structure within the polypyrimidine tract of TNNT2 intron 4 during spliceosome assembly. Required for the export of mRNA out of the nucleus, even if the mRNA is encoded by an intron-less gene. Represses the splicing of MAPT/Tau exon 10. Belongs to the splicing factor SR family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; Spliceosome; RNA splicing

Chromosomal Location of Human Ortholog: 19q13.42

Cellular Component: nucleoplasm; spliceosome; nuclear speck

Molecular Function: protein binding; enzyme binding; nucleotide binding

Biological Process: transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; mRNA export from nucleus; negative regulation of nuclear mRNA splicing, via spliceosome; RNA splicing; gene expression; mRNA 3'-end processing; mRNA processing; termination of RNA polymerase II transcription; positive regulation of RNA splicing