Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged HSF1 is 3 ng/ml as a capture antibody.)

Mouse HSF1 Monoclonal Antibody | anti-HSF1 antibody

HSF1 (Heat Shock Transcription Factor 1, HSTF1) (HRP)

Gene Names
HSF1; HSTF1
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
HSF1; Monoclonal Antibody; HSF1 (Heat Shock Transcription Factor 1; HSTF1) (HRP); Heat Shock Transcription Factor 1; HSTF1; anti-HSF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A11
Specificity
Recognizes HSF1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-HSF1 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HSF1 (NP_005517.1, 256aa-359aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEG
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HSF1 is 3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HSF1 is 3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HSF1 on HeLa cell. [antibody concentration 20 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HSF1 on HeLa cell. [antibody concentration 20 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HSF1 on HeLa cell. [antibody concentration 20 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HSF1 on HeLa cell. [antibody concentration 20 ug/ml])
Product Categories/Family for anti-HSF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,260 Da
NCBI Official Full Name
heat shock factor protein 1
NCBI Official Synonym Full Names
heat shock transcription factor 1
NCBI Official Symbol
HSF1
NCBI Official Synonym Symbols
HSTF1
NCBI Protein Information
heat shock factor protein 1; HSF 1; HSTF 1
UniProt Protein Name
Heat shock factor protein 1
Protein Family
UniProt Gene Name
HSF1
UniProt Synonym Gene Names
HSTF1; HSF 1; HSTF 1
UniProt Entry Name
HSF1_HUMAN

NCBI Description

The product of this gene is a heat-shock transcription factor. Transcription of heat-shock genes is rapidly induced after temperature stress. Hsp90, by itself and/or associated with multichaperone complexes, is a major repressor of this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

HSF1: a transcription factor that specifically binds heat shock promoter elements (HSE) and activates transcription. Induced in response to heat, heavy metals, and oxidative stress. In higher eukaryotes, HSF is unable to bind to HSEs unless the cells are stressed. Becomes phosphorylated in response to stress, forming homotrimers that bind DNA and activate transcription. Phosphorylation by PLK1 enhances nuclear translocation, and phosphorylation by CaMKII enhances transactivation. Phosphorylation by GSK3 and ERK1 induces binding by 14-3-3 and sequestration in the cytoplasm. In addition, during attenuation from the heat shock response, HSF1 is repressed by direct binding of Hsp70, HSP40, and HSF binding protein 1 (HSBP1). Four alternatively spliced isoforms have been described.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: nucleoplasm; protein complex; pronucleus; cytoplasm; cytosol

Molecular Function: protein binding; chromatin binding; transcription factor activity

Biological Process: negative regulation of cell proliferation; embryonic placenta development; embryonic process involved in female pregnancy; mRNA transcription; female meiosis; defense response; spermatogenesis; response to lipopolysaccharide; positive regulation of transcription from RNA polymerase II promoter; negative regulation of tumor necrosis factor production; positive regulation of multicellular organism growth; negative regulation of transcription from RNA polymerase II promoter; protein amino acid phosphorylation

Research Articles on HSF1

Similar Products

Product Notes

The HSF1 hsf1 (Catalog #AAA6182908) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HSF1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSF1 hsf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.