Mouse ZBTB20 Monoclonal Antibody | anti-ZBTB20 antibody

ZBTB20 (Zinc Finger and BTB Domain Containing 20, DKFZp566F123, DPZF, HOF, ODA-8S, ZNF288) (FITC)

Cat. Num. AAA6178764

• Gene Names: ZBTB20; HOF; DPZF; PRIMS; ODA-8S; ZNF288
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: ZBTB20; Monoclonal Antibody; ZBTB20 (Zinc Finger and BTB Domain Containing 20; DKFZp566F123; DPZF; HOF; ODA-8S; ZNF288) (FITC); Zinc Finger and BTB Domain Containing 20; ZNF288; anti-ZBTB20 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F3
• Specificity: Recognizes ZBTB20.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ZBTB20 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ZBTB20 (NP_056457, 451aa-542aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FLFSLPQPLAGQQTQFVTVSQPGLSTFTAQLPAPQPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVHTGEKPHQCSICWRSF
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ZBTB20 is 0.3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZBTB20 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZBTB20 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-ZBTB20 antibody

Mouse monoclonal antibody raised against a partial recombinant ZBTB20.

Product Categories/Family for anti-ZBTB20 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 257900537
• NCBI GeneID: 26137
• NCBI Accession #: NP_056457
• NCBI GenBank Nucleotide #: NM_015642
• UniProt Accession #: Q9HC78
• Molecular Weight: 73kDa
• NCBI Official Full Name: zinc finger and BTB domain-containing protein 20 isoform 2
• NCBI Official Synonym Full Names: zinc finger and BTB domain containing 20
• NCBI Official Symbol: ZBTB20
• NCBI Official Synonym Symbols: HOF; DPZF; PRIMS; ODA-8S; ZNF288
• NCBI Protein Information: zinc finger and BTB domain-containing protein 20
• UniProt Protein Name: Zinc finger and BTB domain-containing protein 20
• Protein Family: Zinc finger and BTB domain-containing protein
• UniProt Gene Name: ZBTB20
• UniProt Synonym Gene Names: DPZF; ZNF288
• UniProt Entry Name: ZBT20_HUMAN

NCBI Description

This gene, which was initially designated as dendritic cell-derived BTB/POZ zinc finger (DPZF), belongs to a family of transcription factors with an N-terminal BTB/POZ domain and a C-terminal DNA-bindng zinc finger domain. The BTB/POZ domain is a hydrophobic region of approximately 120 aa which mediates association with other BTB/POZ domain-containing proteins. This gene acts as a transcriptional repressor and plays a role in many processes including neurogenesis, glucose homeostasis, and postnatal growth. Mutations in this gene have been associated with Primrose syndrome as well as the 3q13.31 microdeletion syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2017]