Mouse PIK3C2B Monoclonal Antibody | anti-PIK3C2B antibody

PIK3C2B (Phosphoinositide-3-Kinase, Class 2, beta Polypeptide, C2-PI3K, DKFZp686G16234) (FITC)

Cat. Num. AAA6177438

• Gene Names: PIK3C2B; C2-PI3K
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: PIK3C2B; Monoclonal Antibody; PIK3C2B (Phosphoinositide-3-Kinase; Class 2; beta Polypeptide; C2-PI3K; DKFZp686G16234) (FITC); Phosphoinositide-3-Kinase; DKFZp686G16234; anti-PIK3C2B antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1H4
• Specificity: Recognizes PIK3C2B.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 1634

• Applicable Applications for anti-PIK3C2B antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PIK3C2B (NP_002637, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSSTQDNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISWDEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQG
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PIK3C2B monoclonal antibody (M06), clone 1H4. Western Blot analysis of PIK3C2B expression in Hela S3 NE (Cat # L013V3).)

Testing Data

(Detection limit for recombinant GST tagged PIK3C2B is approximately 0.03ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PIK3C2B on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PIK3C2B on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-PIK3C2B antibody

The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is sensitive to low nanomolar levels of the inhibitor wortmanin. The C2 domain of this protein was shown to bind phospholipids but not Ca2+, which suggests that this enzyme may function in a calcium-independent manner. [provided by RefSeq]

Product Categories/Family for anti-PIK3C2B antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 194097347
• NCBI GeneID: 5287
• NCBI Accession #: NP_002637
• NCBI GenBank Nucleotide #: NP_002637.3
• UniProt Accession #: O00750
• NCBI Official Full Name: phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta isoform 1
• NCBI Official Synonym Full Names: phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta
• NCBI Official Symbol: PIK3C2B
• NCBI Official Synonym Symbols: C2-PI3K
• NCBI Protein Information: phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
• UniProt Protein Name: Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
• Protein Family: Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing
• UniProt Gene Name: PIK3C2B
• UniProt Synonym Gene Names: PI3K-C2-beta; PtdIns-3-kinase C2 subunit beta
• UniProt Entry Name: P3C2B_HUMAN

NCBI Description

The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is sensitive to low nanomolar levels of the inhibitor wortmanin. The C2 domain of this protein was shown to bind phospholipids but not Ca2+, which suggests that this enzyme may function in a calcium-independent manner. [provided by RefSeq, Jul 2008]