Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PIK3C2B monoclonal antibody (M06), clone 1H4. Western Blot analysis of PIK3C2B expression in Hela S3 NE.)

Mouse PIK3C2B Monoclonal Antibody | anti-PIK3C2B antibody

PIK3C2B (Phosphoinositide-3-Kinase, Class 2, beta Polypeptide, C2-PI3K, DKFZp686G16234) (APC)

Gene Names
PIK3C2B; C2-PI3K
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
PIK3C2B; Monoclonal Antibody; PIK3C2B (Phosphoinositide-3-Kinase; Class 2; beta Polypeptide; C2-PI3K; DKFZp686G16234) (APC); Phosphoinositide-3-Kinase; DKFZp686G16234; anti-PIK3C2B antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H4
Specificity
Recognizes PIK3C2B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1634
Applicable Applications for anti-PIK3C2B antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PIK3C2B (NP_002637, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSTQDNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISWDEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQG
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PIK3C2B monoclonal antibody (M06), clone 1H4. Western Blot analysis of PIK3C2B expression in Hela S3 NE.)

Western Blot (WB) (PIK3C2B monoclonal antibody (M06), clone 1H4. Western Blot analysis of PIK3C2B expression in Hela S3 NE.)

Testing Data

(Detection limit for recombinant GST tagged PIK3C2B is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PIK3C2B is approximately 0.03ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PIK3C2B on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PIK3C2B on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PIK3C2B on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PIK3C2B on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-PIK3C2B antibody
The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is sensitive to low nanomolar levels of the inhibitor wortmanin. The C2 domain of this protein was shown to bind phospholipids but not Ca2+, which suggests that this enzyme may function in a calcium-independent manner. [provided by RefSeq]
Product Categories/Family for anti-PIK3C2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta isoform 1
NCBI Official Synonym Full Names
phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta
NCBI Official Symbol
PIK3C2B
NCBI Official Synonym Symbols
C2-PI3K
NCBI Protein Information
phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
UniProt Protein Name
Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
UniProt Gene Name
PIK3C2B
UniProt Synonym Gene Names
PI3K-C2-beta; PtdIns-3-kinase C2 subunit beta
UniProt Entry Name
P3C2B_HUMAN

NCBI Description

The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is sensitive to low nanomolar levels of the inhibitor wortmanin. The C2 domain of this protein was shown to bind phospholipids but not Ca2+, which suggests that this enzyme may function in a calcium-independent manner. [provided by RefSeq, Jul 2008]

Research Articles on PIK3C2B

Similar Products

Product Notes

The PIK3C2B pik3c2b (Catalog #AAA6168618) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PIK3C2B can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIK3C2B pik3c2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIK3C2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.