Mouse anti-Human DDB2 Monoclonal Antibody | anti-DDB2 antibody

DDB2 (DNA Damage-binding Protein 2, DDB p48 Subunit, DDBb, Damage-specific DNA-binding Protein 2, UV-damaged DNA-binding Protein 2, UV-DDB 2) (AP)

Cat. Num. AAA6130888

• Gene Names: DDB2; XPE; DDBB; UV-DDB2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DDB2; Monoclonal Antibody; DDB2 (DNA Damage-binding Protein 2; DDB p48 Subunit; DDBb; Damage-specific DNA-binding Protein 2; UV-damaged DNA-binding Protein 2; UV-DDB 2) (AP); anti-DDB2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1F11
• Specificity: Recognizes human DDB2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-DDB2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-109 from human DDB2 (AAH00093) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAP
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Related Product Information for anti-DDB2 antibody

DDB2 is required for expression of an ultraviolet radiation (UV)-damaged DNA-binding activity and is disrupted by mutations in the subset of xeroderma pigmentosum group E cells that lack this activity, DDB-negative XPE. DDB2 is the smaller subunit of a heterodimeric protein implicated in the etiology of xeroderma pigmentosum group E. This subunit appears to be required for DNA binding.

Product Categories/Family for anti-DDB2 antibody

Antibodies; DNA Repair/Damage

NCBI and Uniprot Product Information

• NCBI GI #: 34783036
• NCBI GeneID: 1643
• Molecular Weight: 26,758 Da
• NCBI Official Full Name: Homo sapiens damage-specific DNA binding protein 2, 48kDa, mRNA
• NCBI Official Synonym Full Names: damage specific DNA binding protein 2
• NCBI Official Symbol: DDB2
• NCBI Official Synonym Symbols: XPE; DDBB; UV-DDB2
• NCBI Protein Information: DNA damage-binding protein 2
• Protein Family: DNA damage-binding protein

NCBI Description

This gene encodes a protein that is necessary for the repair of ultraviolet light-damaged DNA. This protein is the smaller subunit of a heterodimeric protein complex that participates in nucleotide excision repair, and this complex mediates the ubiquitylation of histones H3 and H4, which facilitates the cellular response to DNA damage. This subunit appears to be required for DNA binding. Mutations in this gene cause xeroderma pigmentosum complementation group E, a recessive disease that is characterized by an increased sensitivity to UV light and a high predisposition for skin cancer development, in some cases accompanied by neurological abnormalities. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]