Mouse FGF1 Monoclonal Antibody | anti-FGF1 antibody

FGF1 (Fibroblast Growth Factor 1 (Acidic), AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-alpha, FGFA, GLIO703, HBGF1) (FITC)

Cat. Num. AAA6174814

• Gene Names: FGF1; AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: FGF1; Monoclonal Antibody; FGF1 (Fibroblast Growth Factor 1 (Acidic); AFGF; ECGF; ECGF-beta; ECGFA; ECGFB; FGF-alpha; FGFA; GLIO703; HBGF1) (FITC); Fibroblast Growth Factor 1 (Acidic); HBGF1; anti-FGF1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3F5
• Specificity: Recognizes human FGF1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 155

• Applicable Applications for anti-FGF1 antibody: mmunofluorescence (IF), Western Blot (WB), In situ Proximity Ligation Assay (Cell)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa46-155 from human FGF1 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen using (37.73KD))

Immunofluorescence (IF)

(Immunofluorescence of (10 ug/ml) on HeLa cell.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between FGFR2 and FGF1. HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data

Related Product Information for anti-FGF1 antibody

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq]

Product Categories/Family for anti-FGF1 antibody

Antibodies; Growth Factors; Cytokines

References

1. Acidic Fibroblast Growth Factor (FGF) Potentiates Glial-mediated Neurotoxicity by Activating FGFR2 IIIb Protein. Lee M, Kang Y, Suk K, Schwab C, Yu S, McGeer PL.J Biol Chem. 2011 Dec 2;286(48):41230-45. Epub 2011 Oct 11.

NCBI and Uniprot Product Information

• NCBI GI #: 21595687
• NCBI GeneID: 2246
• NCBI Official Full Name: FGF1 protein
• NCBI Official Synonym Full Names: fibroblast growth factor 1
• NCBI Official Symbol: FGF1
• NCBI Official Synonym Symbols: AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
• NCBI Protein Information: fibroblast growth factor 1
• Protein Family: Fibroblast growth factor

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009]