Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse NRK Monoclonal Antibody | anti-NRK antibody

NRK (Nik Related Kinase, DKFZp686A17109, FLJ16788, MGC131849, NESK) (Biotin)

Gene Names
NRK; NESK
Applications
ELISA
Purity
Purified
Synonyms
NRK; Monoclonal Antibody; NRK (Nik Related Kinase; DKFZp686A17109; FLJ16788; MGC131849; NESK) (Biotin); Nik Related Kinase; NESK; anti-NRK antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C7
Specificity
Recognizes NRK.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1582
Applicable Applications for anti-NRK antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NRK (NP_940867, 1483aa-1582aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VEANEQLFKKILEMWKDIPSSIAFECTQRTTGWGQKAIEVRSLQSRVLESELKRRSIKKLRFLCTRGDKLFFTSTLRNHHSRVYFMTLGKLEELQSNYDV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-NRK antibody
NRK is a member of the GCK (MIM 138079) subfamily of protein kinases that are involved in activating the JNK pathway (Kanai-Azuma et al., 1999 [PubMed 10559491]). [supplied by OMIM]
Product Categories/Family for anti-NRK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
nik-related protein kinase
NCBI Official Synonym Full Names
Nik related kinase
NCBI Official Symbol
NRK
NCBI Official Synonym Symbols
NESK
NCBI Protein Information
nik-related protein kinase
UniProt Protein Name
Nik-related protein kinase
UniProt Gene Name
NRK

NCBI Description

The mouse ortholog of this gene encodes a protein kinase required for JNK activation. The encoded protein may be involved in the induction of actin polymerization in late embryogenesis.[provided by RefSeq, Jun 2010]

Uniprot Description

NRK: May phosphorylate cofilin-1 and induce actin polymerization through this process, during the late stages of embryogenesis. Involved in the TNF-alpha-induced signaling pathway. Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.11.1; Kinase, protein; MSN subfamily; Protein kinase, STE; Protein kinase, Ser/Thr (non-receptor); STE group; STE20 family

Chromosomal Location of Human Ortholog: Xq22.3

Cellular Component: cytoplasm

Molecular Function: ATP binding; MAP kinase kinase kinase kinase activity

Biological Process: activation of JNKK activity; activation of MAPKKK activity; negative regulation of cell proliferation; neuron projection morphogenesis; parturition; regulation of apoptosis; regulation of mitotic cell cycle; stress-activated protein kinase signaling pathway

Research Articles on NRK

Similar Products

Product Notes

The NRK nrk (Catalog #AAA6174726) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NRK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NRK nrk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NRK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.