Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CD2 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)

Rabbit CD2 Polyclonal Antibody | anti-CD2 antibody

CD2 antibody - C-terminal region

Gene Names
CD2; T11; SRBC; LFA-2
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD2; Polyclonal Antibody; CD2 antibody - C-terminal region; anti-CD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VALLVFYITKRKKQRSRRNDEELETRAHRVATEERGRKPHQIPASTPQNP
Sequence Length
351
Applicable Applications for anti-CD2 antibody
Western Blot (WB)
Homology
Cow: 77%; Dog: 93%; Horse: 93%; Human: 100%; Pig: 100%; Rabbit: 77%; Sheep: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CD2 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CD2 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
Related Product Information for anti-CD2 antibody
This is a rabbit polyclonal antibody against CD2. It was validated on Western Blot

Target Description: CD2 is a surface antigen of the human T-lymphocyte lineage that is expressed on all peripheral blood T cells (summarized by Sewell et al., 1986 [PubMed 3490670]). It is one of the earliest T-cell markers, being present on more than 95% of thymocytes; it is also found on some natural killer cells but not on B lymphocytes. Monoclonal antibodies directed against CD2 inhibit the formation of rosettes with sheep erythrocytes, indicating that CD2 is the erythrocyte receptor or is closely associated with it.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
914
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
T-cell surface antigen CD2 isoform 2
NCBI Official Synonym Full Names
CD2 molecule
NCBI Official Symbol
CD2
NCBI Official Synonym Symbols
T11; SRBC; LFA-2
NCBI Protein Information
T-cell surface antigen CD2
UniProt Protein Name
T-cell surface antigen CD2
Protein Family
CD2
UniProt Gene Name
CD2
UniProt Synonym Gene Names
SRBC
UniProt Entry Name
CD2_HUMAN

NCBI Description

The protein encoded by this gene is a surface antigen found on all peripheral blood T-cells. The encoded protein interacts with LFA3 (CD58) on antigen presenting cells to optimize immune recognition. A locus control region (LCR) has been found in the 3' flanking sequence of this gene. [provided by RefSeq, Jun 2016]

Uniprot Description

CD2: CD2 interacts with lymphocyte function-associated antigen (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T- cells, the cytoplasmic domain is implicated in the signaling function.

Protein type: Cell surface; Apoptosis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p13.1

Cellular Component: internal side of plasma membrane; cell surface; anchored to plasma membrane; integral to plasma membrane; plasma membrane; extracellular region; intercellular junction; external side of plasma membrane

Molecular Function: protein binding; protein homodimerization activity; receptor activity; receptor binding

Biological Process: heterotypic cell-cell adhesion; cell-cell adhesion; cell surface receptor linked signal transduction; T cell activation; apoptosis; natural killer cell activation; regulation of T cell differentiation; blood coagulation; lipid raft polarization; positive regulation of tumor necrosis factor production; leukocyte migration; positive regulation of myeloid dendritic cell activation

Research Articles on CD2

Similar Products

Product Notes

The CD2 cd2 (Catalog #AAA3215827) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD2 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD2 cd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VALLVFYITK RKKQRSRRND EELETRAHRV ATEERGRKPH QIPASTPQNP. It is sometimes possible for the material contained within the vial of "CD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.