Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CYP1A2 is 0.1 ng/ml as a capture antibody.)

Mouse CYP1A2 Monoclonal Antibody | anti-CYP1A2 antibody

CYP1A2 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2, CP12, P3-450, P450(PA)) (Biotin)

Gene Names
CYP1A2; CP12; P3-450; P450(PA)
Applications
Western Blot
Purity
Purified
Synonyms
CYP1A2; Monoclonal Antibody; CYP1A2 (Cytochrome P450; Family 1; Subfamily A; Polypeptide 2; CP12; P3-450; P450(PA)) (Biotin); Cytochrome P450; P450(PA); anti-CYP1A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
2G5
Specificity
Recognizes CYP1A2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CYP1A2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CYP1A2 (NP_000752, 211aa-310aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQEKIVNL
Conjugate
Biotin
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CYP1A2 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CYP1A2 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-CYP1A2 antibody
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. Other xenobiotic substrates for this enzyme include caffeine, aflatoxin B1, and acetaminophen. The transcript from this gene contains four Alu sequences flanked by direct repeats in the 3' untranslated region. [provided by RefSeq]
Product Categories/Family for anti-CYP1A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,407 Da
NCBI Official Full Name
cytochrome P450 1A2
NCBI Official Synonym Full Names
cytochrome P450, family 1, subfamily A, polypeptide 2
NCBI Official Symbol
CYP1A2
NCBI Official Synonym Symbols
CP12; P3-450; P450(PA)
NCBI Protein Information
cytochrome P450 1A2
UniProt Protein Name
Cytochrome P450 1A2
Protein Family
UniProt Gene Name
CYP1A2
UniProt Entry Name
CP1A2_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. Other xenobiotic substrates for this enzyme include caffeine, aflatoxin B1, and acetaminophen. The transcript from this gene contains four Alu sequences flanked by direct repeats in the 3' untranslated region. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP1A2: Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Most active in catalyzing 2-hydroxylation. Caffeine is metabolized primarily by cytochrome CYP1A2 in the liver through an initial N3-demethylation. Also acts in the metabolism of aflatoxin B1 and acetaminophen. Participates in the bioactivation of carcinogenic aromatic and heterocyclic amines. Catalizes the N-hydroxylation of heterocyclic amines and the O- deethylation of phenacetin. Belongs to the cytochrome P450 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Xenobiotic Metabolism - metabolism by cytochrome P450; Amino Acid Metabolism - tryptophan; Secondary Metabolites Metabolism - caffeine; Lipid Metabolism - linoleic acid; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Cofactor and Vitamin Metabolism - retinol; EC 1.14.14.1; Oxidoreductase

Chromosomal Location of Human Ortholog: 15q24.1

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle

Molecular Function: enzyme binding; electron carrier activity; iron ion binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; heme binding; oxidoreductase activity; monooxygenase activity; demethylase activity

Biological Process: methylation; dibenzo-p-dioxin metabolic process; cellular respiration; monoterpenoid metabolic process; toxin biosynthetic process; epoxygenase P450 pathway; response to lipopolysaccharide; monocarboxylic acid metabolic process; response to estradiol stimulus; post-embryonic development; drug catabolic process; regulation of gene expression; xenobiotic metabolic process; porphyrin metabolic process; exogenous drug catabolic process; arachidonic acid metabolic process; alkaloid metabolic process; heterocycle metabolic process; drug metabolic process; hydrogen peroxide biosynthetic process; steroid catabolic process; lung development

Research Articles on CYP1A2

Similar Products

Product Notes

The CYP1A2 cyp1a2 (Catalog #AAA6174313) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CYP1A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CYP1A2 cyp1a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CYP1A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.