Mouse CYP1A2 Monoclonal Antibody | anti-CYP1A2 antibody

CYP1A2 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2, CP12, P3-450, P450(PA)) (AP)

Cat. Num. AAA6165493

• Gene Names: CYP1A2; CP12; P3-450; P450(PA)
• Applications: Western Blot
• Purity: Purified
• Synonyms: CYP1A2; Monoclonal Antibody; CYP1A2 (Cytochrome P450; Family 1; Subfamily A; Polypeptide 2; CP12; P3-450; P450(PA)) (AP); Cytochrome P450; P450(PA); anti-CYP1A2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 2G5
• Specificity: Recognizes CYP1A2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-CYP1A2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CYP1A2 (NP_000752, 211aa-310aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQEKIVNL
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CYP1A2 is 0.1 ng/ml as a capture antibody.)

Related Product Information for anti-CYP1A2 antibody

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. Other xenobiotic substrates for this enzyme include caffeine, aflatoxin B1, and acetaminophen. The transcript from this gene contains four Alu sequences flanked by direct repeats in the 3' untranslated region. [provided by RefSeq]

Product Categories/Family for anti-CYP1A2 antibody

Antibodies; Enzymes; Cytochrome

NCBI and Uniprot Product Information

• NCBI GI #: 73915100
• NCBI GeneID: 1544
• NCBI Accession #: NP_000752
• NCBI GenBank Nucleotide #: NM_000761.3
• UniProt Accession #: P05177; Q16754; Q6NWU5; Q9BXX7; Q9UK49
• Molecular Weight: 58,407 Da
• NCBI Official Full Name: cytochrome P450 1A2
• NCBI Official Synonym Full Names: cytochrome P450, family 1, subfamily A, polypeptide 2
• NCBI Official Symbol: CYP1A2
• NCBI Official Synonym Symbols: CP12; P3-450; P450(PA)
• NCBI Protein Information: cytochrome P450 1A2
• UniProt Protein Name: Cytochrome P450 1A2
• Protein Family: Cytochrome
• UniProt Gene Name: CYP1A2
• UniProt Entry Name: CP1A2_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. Other xenobiotic substrates for this enzyme include caffeine, aflatoxin B1, and acetaminophen. The transcript from this gene contains four Alu sequences flanked by direct repeats in the 3' untranslated region. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP1A2: Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Most active in catalyzing 2-hydroxylation. Caffeine is metabolized primarily by cytochrome CYP1A2 in the liver through an initial N3-demethylation. Also acts in the metabolism of aflatoxin B1 and acetaminophen. Participates in the bioactivation of carcinogenic aromatic and heterocyclic amines. Catalizes the N-hydroxylation of heterocyclic amines and the O- deethylation of phenacetin. Belongs to the cytochrome P450 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Xenobiotic Metabolism - metabolism by cytochrome P450; Amino Acid Metabolism - tryptophan; Secondary Metabolites Metabolism - caffeine; Lipid Metabolism - linoleic acid; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Cofactor and Vitamin Metabolism - retinol; EC 1.14.14.1; Oxidoreductase

Chromosomal Location of Human Ortholog: 15q24.1

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle

Molecular Function: enzyme binding; electron carrier activity; iron ion binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; heme binding; oxidoreductase activity; monooxygenase activity; demethylase activity

Biological Process: methylation; dibenzo-p-dioxin metabolic process; cellular respiration; monoterpenoid metabolic process; toxin biosynthetic process; epoxygenase P450 pathway; response to lipopolysaccharide; monocarboxylic acid metabolic process; response to estradiol stimulus; post-embryonic development; drug catabolic process; regulation of gene expression; xenobiotic metabolic process; porphyrin metabolic process; exogenous drug catabolic process; arachidonic acid metabolic process; alkaloid metabolic process; heterocycle metabolic process; drug metabolic process; hydrogen peroxide biosynthetic process; steroid catabolic process; lung development