Mouse SGK2 Monoclonal Antibody | anti-SGK2 antibody

SGK2 (Serum/Glucocorticoid Regulated Kinase 2, H-SGK2, dJ138B7.2) (Biotin)

Cat. Num. AAA6172274

• Gene Names: SGK2; H-SGK2; dJ138B7.2
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: SGK2; Monoclonal Antibody; SGK2 (Serum/Glucocorticoid Regulated Kinase 2; H-SGK2; dJ138B7.2) (Biotin); Serum/Glucocorticoid Regulated Kinase 2; dJ138B7.2; anti-SGK2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G11
• Specificity: Recognizes SGK2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 427

• Applicable Applications for anti-SGK2 antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SGK2 (NP_057360, 244aa-344aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFL
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to SGK2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SGK2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml])

Related Product Information for anti-SGK2 antibody

This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Two alternate transcripts encoding two different isoforms have been described. [provided by RefSeq]

Product Categories/Family for anti-SGK2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 20127541
• NCBI GeneID: 10110
• NCBI Accession #: NP_057360
• NCBI GenBank Nucleotide #: NP_057360.2
• UniProt Accession #: Q9HBY8
• NCBI Official Full Name: serine/threonine-protein kinase Sgk2 isoform beta
• NCBI Official Synonym Full Names: serum/glucocorticoid regulated kinase 2
• NCBI Official Symbol: SGK2
• NCBI Official Synonym Symbols: H-SGK2; dJ138B7.2
• NCBI Protein Information: serine/threonine-protein kinase Sgk2
• UniProt Protein Name: Serine/threonine-protein kinase Sgk2
• Protein Family: Serine/threonine-protein kinase
• UniProt Gene Name: SGK2
• UniProt Entry Name: SGK2_HUMAN

NCBI Description

This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]

Uniprot Description

SGK2: Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cell growth, survival and proliferation. Up- regulates Na(+) channels: SCNN1A/ENAC, K(+) channels: KCNA3/Kv1.3, KCNE1 and KCNQ1, amino acid transporter: SLC6A19, glutamate transporter: SLC1A6/EAAT4, glutamate receptors: GRIA1/GLUR1 and GRIK2/GLUR6, Na(+)/H(+) exchanger: SLC9A3/NHE3, and the Na(+)/K(+) ATPase. Highly expressed in liver, kidney and pancreas, and at lower levels in brain. Two specific sites, one in the kinase domain (Thr-253) and the other in the C-terminal regulatory region (Ser- 416), need to be phsphorylated for its full activation. Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, AGC; Kinase, protein; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); AGC group; SGK family

Chromosomal Location of Human Ortholog: 20q13.2

Cellular Component: nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; potassium channel regulator activity; sodium channel regulator activity; ATP binding

Biological Process: positive regulation of transporter activity; regulation of cell growth; response to oxidative stress; transmembrane transport; protein amino acid phosphorylation; regulation of cell proliferation