Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SGK2 expression in transfected 293T cell line by SGK2 monoclonal antibody (M17), clone 2F6.Lane 1: SGK2 transfected lysate(41.2 KDa).Lane 2: Non-transfected lysate.)

Mouse SGK2 Monoclonal Antibody | anti-SGK2 antibody

SGK2 (Serum/Glucocorticoid Regulated Kinase 2, H-SGK2, dJ138B7.2) (Biotin)

Gene Names
SGK2; H-SGK2; dJ138B7.2
Applications
ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
SGK2; Monoclonal Antibody; SGK2 (Serum/Glucocorticoid Regulated Kinase 2; H-SGK2; dJ138B7.2) (Biotin); Serum/Glucocorticoid Regulated Kinase 2; dJ138B7.2; anti-SGK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F6
Specificity
Recognizes SGK2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
427
Applicable Applications for anti-SGK2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SGK2 (NP_057360, 244aa-344aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SGK2 expression in transfected 293T cell line by SGK2 monoclonal antibody (M17), clone 2F6.Lane 1: SGK2 transfected lysate(41.2 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SGK2 expression in transfected 293T cell line by SGK2 monoclonal antibody (M17), clone 2F6.Lane 1: SGK2 transfected lysate(41.2 KDa).Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of SGK2 transfected lysate using anti-SGK2 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with SGK2 MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of SGK2 transfected lysate using anti-SGK2 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with SGK2 MaxPab rabbit polyclonal antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-SGK2 antibody
This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Two alternate transcripts encoding two different isoforms have been described. [provided by RefSeq]
Product Categories/Family for anti-SGK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
serine/threonine-protein kinase Sgk2 isoform beta
NCBI Official Synonym Full Names
serum/glucocorticoid regulated kinase 2
NCBI Official Symbol
SGK2
NCBI Official Synonym Symbols
H-SGK2; dJ138B7.2
NCBI Protein Information
serine/threonine-protein kinase Sgk2
UniProt Protein Name
Serine/threonine-protein kinase Sgk2
UniProt Gene Name
SGK2
UniProt Entry Name
SGK2_HUMAN

NCBI Description

This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]

Uniprot Description

SGK2: Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cell growth, survival and proliferation. Up- regulates Na(+) channels: SCNN1A/ENAC, K(+) channels: KCNA3/Kv1.3, KCNE1 and KCNQ1, amino acid transporter: SLC6A19, glutamate transporter: SLC1A6/EAAT4, glutamate receptors: GRIA1/GLUR1 and GRIK2/GLUR6, Na(+)/H(+) exchanger: SLC9A3/NHE3, and the Na(+)/K(+) ATPase. Highly expressed in liver, kidney and pancreas, and at lower levels in brain. Two specific sites, one in the kinase domain (Thr-253) and the other in the C-terminal regulatory region (Ser- 416), need to be phsphorylated for its full activation. Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, AGC; Kinase, protein; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); AGC group; SGK family

Chromosomal Location of Human Ortholog: 20q13.2

Cellular Component: nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; potassium channel regulator activity; sodium channel regulator activity; ATP binding

Biological Process: positive regulation of transporter activity; regulation of cell growth; response to oxidative stress; transmembrane transport; protein amino acid phosphorylation; regulation of cell proliferation

Research Articles on SGK2

Similar Products

Product Notes

The SGK2 sgk2 (Catalog #AAA6172275) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SGK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SGK2 sgk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SGK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.