Mouse NME4 Monoclonal Antibody | anti-NME4 antibody

NME4 (Non-Metastatic Cells 4, Protein Expressed in, NDPK-D, NM23H4, nm23-H4) (APC)

Cat. Num. AAA6170352

• Gene Names: NME4; NDPK-D; NM23H4; nm23-H4
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: NME4; Monoclonal Antibody; NME4 (Non-Metastatic Cells 4; Protein Expressed in; NDPK-D; NM23H4; nm23-H4) (APC); Non-Metastatic Cells 4; nm23-H4; anti-NME4 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4B6
• Specificity: Recognizes NME4.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-NME4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NME4 (NP_005000.1, 99aa-187aa) partial recombinant protein with GST tag.
• Immunogen Sequence: RYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NME4 is 0.1 ng/ml as a capture antibody.)

Related Product Information for anti-NME4 antibody

Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Alternative splice variants encoding the same protein have been identified at this locus. [provided by RefSeq]

Product Categories/Family for anti-NME4 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4826862
• NCBI GeneID: 4833
• NCBI Accession #: NP_005000.1
• NCBI GenBank Nucleotide #: NM_005009.2
• UniProt Accession #: O00746; Q5U0M9
• Molecular Weight: 20,659 Da
• NCBI Official Full Name: nucleoside diphosphate kinase, mitochondrial
• NCBI Official Synonym Full Names: NME/NM23 nucleoside diphosphate kinase 4
• NCBI Official Symbol: NME4
• NCBI Official Synonym Symbols: NDPK-D; NM23H4; nm23-H4
• NCBI Protein Information: nucleoside diphosphate kinase, mitochondrial; NDK; NDPKD; NDP kinase D; NDP kinase, mitochondrial; nucleoside diphosphate kinase D; non-metastatic cells 4, protein expressed in
• UniProt Protein Name: Nucleoside diphosphate kinase, mitochondrial
• UniProt Gene Name: NME4
• UniProt Synonym Gene Names: NM23D; NDK; NDP kinase, mitochondrial; NDPKD
• UniProt Entry Name: NDKM_HUMAN

NCBI Description

The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM, May 2008]

Uniprot Description

NME4: Major role in the synthesis of nucleoside triphosphates other than ATP. Belongs to the NDK family.

Protein type: Kinase, other; Nucleotide Metabolism - purine; EC 2.7.4.6; Kinase, nucleoside diphosphate; Nucleotide Metabolism - pyrimidine; Mitochondrial; Other group; NDK family

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial intermembrane space; cytosol

Molecular Function: protein binding; metal ion binding; nucleoside diphosphate kinase activity; protein complex binding; ATP binding

Biological Process: regulation of apoptosis; GTP biosynthetic process; CTP biosynthetic process; nucleobase, nucleoside and nucleotide metabolic process; pyrimidine nucleotide metabolic process; nucleobase, nucleoside and nucleotide interconversion; UTP biosynthetic process; nucleoside triphosphate biosynthetic process; nucleoside metabolic process; nucleoside diphosphate phosphorylation; purine nucleotide metabolic process