Mouse SUMO3 Monoclonal Antibody | anti-SUMO3 antibody

SUMO3 (SMT3 Suppressor of mif two 3 Homolog 3 (S. cerevisiae), SMT3A, SMT3H1, SUMO-3) (APC)

Cat. Num. AAA6168691

• Gene Names: SUMO3; SMT3A; Smt3B; SMT3H1; SUMO-3
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: SUMO3; Monoclonal Antibody; SUMO3 (SMT3 Suppressor of mif two 3 Homolog 3 (S. cerevisiae); SMT3A; SMT3H1; SUMO-3) (APC); SMT3 Suppressor of mif two 3 Homolog 3 (S. cerevisiae); SUMO-3; anti-SUMO3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4B9
• Specificity: Recognizes SUMO3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-SUMO3 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SUMO3 (NP_008867, 1aa-103aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SUMO3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SUMO3 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-SUMO3 antibody

SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability (Su and Li, 2002 [PubMed 12383504]). [supplied by OMIM].

Product Categories/Family for anti-SUMO3 antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 48928058
• NCBI GeneID: 6612
• NCBI Accession #: NP_008867
• NCBI GenBank Nucleotide #: NM_006936.2
• UniProt Accession #: P55854; Q53HI9; Q6FGD4; Q9BWR4; B2R5X4; B4DUW4
• Molecular Weight: 15,768 Da
• NCBI Official Full Name: small ubiquitin-related modifier 3 isoform 1
• NCBI Official Synonym Full Names: small ubiquitin-like modifier 3
• NCBI Official Symbol: SUMO3
• NCBI Official Synonym Symbols: SMT3A; Smt3B; SMT3H1; SUMO-3
• NCBI Protein Information: small ubiquitin-related modifier 3; ubiquitin-like protein SMT3B; SMT3 suppressor of mif two 3 homolog 1; SMT3 suppressor of mif two 3 homolog 3
• UniProt Protein Name: Small ubiquitin-related modifier 3
• Protein Family: Small ubiquitin-related modifier
• UniProt Gene Name: SUMO3
• UniProt Synonym Gene Names: SUMO-3Curated
• UniProt Entry Name: SUMO3_HUMAN

NCBI Description

This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq, Feb 2014]

Uniprot Description

SUMO3: Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. Covalently attached to a number of proteins. Interacts with USP25 (via ts SIM domain); the interaction sumoylates USP25 and inhibits its ubiquitin hydrolyzing activity. Interacts with SAE2 and UBE2I. Expressed predominantly in liver. Belongs to the ubiquitin family. SUMO subfamily.

Protein type: Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: kinetochore; nucleoplasm; PML body; cytoplasm; nucleus

Molecular Function: protein binding; SUMO ligase activity

Biological Process: cellular protein metabolic process; protein sumoylation; post-translational protein modification