Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged HDAC8 is 0.3 ng/ml as a capture antibody.)

Mouse HDAC8 Monoclonal Antibody | anti-HDAC8 antibody

HDAC8 (Histone Deacetylase 8, HDACL1, RPD3) (AP)

Gene Names
HDAC8; HD8; WTS; RPD3; CDA07; CDLS5; MRXS6; HDACL1
Applications
Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
HDAC8; Monoclonal Antibody; HDAC8 (Histone Deacetylase 8; HDACL1; RPD3) (AP); Histone Deacetylase 8; RPD3; anti-HDAC8 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F4
Specificity
Recognizes HDAC8.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HDAC8 antibody
Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HDAC8 (NP_060956.1, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGY
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HDAC8 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HDAC8 is 0.3 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of HDAC8 expression in transfected 293T cell line by HDAC8 monoclonal antibody (M07), clone 2F4.Lane 1: HDAC8 transfected lysate(41.8 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HDAC8 expression in transfected 293T cell line by HDAC8 monoclonal antibody (M07), clone 2F4.Lane 1: HDAC8 transfected lysate(41.8 KDa).Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of HDAC8 transfected lysate using anti-HDAC8 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with HDAC8 MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of HDAC8 transfected lysate using anti-HDAC8 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with HDAC8 MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-HDAC8 antibody
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class I of the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. [provided by RefSeq]
Product Categories/Family for anti-HDAC8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,935 Da
NCBI Official Full Name
histone deacetylase 8 isoform 1
NCBI Official Synonym Full Names
histone deacetylase 8
NCBI Official Symbol
HDAC8
NCBI Official Synonym Symbols
HD8; WTS; RPD3; CDA07; CDLS5; MRXS6; HDACL1
NCBI Protein Information
histone deacetylase 8
UniProt Protein Name
Histone deacetylase 8
UniProt Gene Name
HDAC8
UniProt Synonym Gene Names
HDACL1; HD8
UniProt Entry Name
HDAC8_HUMAN

NCBI Description

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class I of the histone deacetylase family. It catalyzes the deacetylation of lysine residues in the histone N-terminal tails and represses transcription in large multiprotein complexes with transcriptional co-repressors. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]

Uniprot Description

HDAC8: Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. May play a role in smooth muscle cell contractility. Belongs to the histone deacetylase family. HD type 1 subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.5.1.98; Hydrolase

Chromosomal Location of Human Ortholog: Xq13

Cellular Component: nucleoplasm; nuclear chromosome; histone deacetylase complex; cytoplasm; plasma membrane; cytosol; nucleus

Molecular Function: NAD-dependent histone deacetylase activity (H3-K9 specific); NAD-dependent histone deacetylase activity (H3-K14 specific); metal ion binding; NAD-dependent histone deacetylase activity (H4-K16 specific); histone deacetylase activity; transcription factor binding

Biological Process: chromatin assembly or disassembly; establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; sister chromatid cohesion; mitotic cell cycle; chromatin modification; negative regulation of transcription from RNA polymerase II promoter

Disease: Wilson-turner X-linked Mental Retardation Syndrome

Research Articles on HDAC8

Similar Products

Product Notes

The HDAC8 hdac8 (Catalog #AAA6164603) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HDAC8 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HDAC8 hdac8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HDAC8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.