Mouse MUSK Monoclonal Antibody | anti-MUSK antibody

MUSK (Muscle, Skeletal, Receptor Tyrosine Kinase, MGC126323, MGC126324) (AP)

Cat. Num. AAA6162689

• Gene Names: MUSK; CMS9; FADS; FADS1
• Applications: Western Blot
• Purity: Purified
• Synonyms: MUSK; Monoclonal Antibody; MUSK (Muscle; Skeletal; Receptor Tyrosine Kinase; MGC126323; MGC126324) (AP); Muscle; MGC126324; anti-MUSK antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C12
• Specificity: Recognizes MUSK.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 869

• Applicable Applications for anti-MUSK antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MUSK (NP_005583, 301aa-400aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLA
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(MUSK monoclonal antibody (M03), clone 4C12 Western Blot analysis of MUSK expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged MUSK is 1 ng/ml as a capture antibody.)

Related Product Information for anti-MUSK antibody

Intercellular communication is often mediated by receptors on the surface of one cell that recognize and are activated by specific protein ligands released by other cells. Members of one class of cell surface receptors, receptor tyrosine kinases (RTKs), are characterized by having a cytoplasmic domain containing intrinsic tyrosine kinase activity. This kinase activity is regulated by the binding of a cognate ligand to the extracellular portion of the receptor. DeChiara et al. (1996) [PubMed 8653786] noted that the RTKs, known to be expressed in cell type-specific fashions, play a role critical for the growth and differentiation of those cell types. For example, members of the neural-specific TRK family that recognize nerve growth factor are absolutely required for the survival and development of discrete neuronal subpopulations, and the receptor tyrosine kinases TIE1 (MIM 600222) and TIE2 (MIM 600221) play a critical role in the development of normal blood vessels. [supplied by OMIM]

Product Categories/Family for anti-MUSK antibody

Antibodies; Tyrosine Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 5031927
• NCBI GeneID: 4593
• NCBI Accession #: NP_005583
• NCBI GenBank Nucleotide #: NP_005583.1
• UniProt Accession #: O15146
• NCBI Official Full Name: muscle, skeletal receptor tyrosine-protein kinase isoform 1
• NCBI Official Synonym Full Names: muscle associated receptor tyrosine kinase
• NCBI Official Symbol: MUSK
• NCBI Official Synonym Symbols: CMS9; FADS; FADS1
• NCBI Protein Information: muscle, skeletal receptor tyrosine-protein kinase
• UniProt Protein Name: Muscle, skeletal receptor tyrosine-protein kinase
• Protein Family: Muskelin
• UniProt Gene Name: MUSK
• UniProt Synonym Gene Names: MuSK
• UniProt Entry Name: MUSK_HUMAN

NCBI Description

This gene encodes a muscle-specific tyrosine kinase receptor. The encoded protein may play a role in clustering of the acetylcholine receptor in the postsynaptic neuromuscular junction. Mutations in this gene have been associated with congenital myasthenic syndrome. Alternatively spliced transcript variants have been described.[provided by RefSeq, Oct 2009]

Uniprot Description

MUSK: a receptor tyrosine kinase that is essential for the establishment and maintenance of the neuromuscular junction (NMJ). Its activation by agrin, a neuronally derived heparan-sulfate proteoglycan, and the agrin receptor (LRP4), leads to clustering of acetylcholine receptors on the postsynaptic side of the NMJ. Its activation by agrin requires Dok7, which interacts with the cytoplasmic portion of MuSK and activates its tyrosine kinase activity.

Protein type: EC 2.7.10.1; Protein kinase, tyrosine (receptor); Protein kinase, TK; Kinase, protein; Membrane protein, integral; TK group; Musk family

Chromosomal Location of Human Ortholog: 9q31.3-q32

Cellular Component: postsynaptic membrane; integral to plasma membrane; cell junction; neuromuscular junction; receptor complex

Molecular Function: protein binding; protein-tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: extracellular matrix organization and biogenesis; peptidyl-tyrosine phosphorylation; regulation of transcription, DNA-dependent; protein amino acid autophosphorylation; positive regulation of neuron apoptosis; multicellular organismal development; regulation of synaptic growth at neuromuscular junction; positive regulation of protein amino acid phosphorylation; cell differentiation; memory; neuromuscular junction development; transmembrane receptor protein tyrosine kinase signaling pathway

Disease: Myasthenic Syndrome, Congenital, 9, Associated With Acetylcholine Receptor Deficiency; Fetal Akinesia Deformation Sequence