Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (IRAK2 monoclonal antibody (M03), clone 3H1 Western Blot analysis of IRAK2 expression in HeLa.)

Mouse IRAK2 Monoclonal Antibody | anti-IRAK2 antibody

IRAK2 (Interleukin-1 Receptor-associated Kinase 2, IRAK-2, MGC150550) (AP)

Gene Names
IRAK2; IRAK-2
Applications
Western Blot
Purity
Purified
Synonyms
IRAK2; Monoclonal Antibody; IRAK2 (Interleukin-1 Receptor-associated Kinase 2; IRAK-2; MGC150550) (AP); Interleukin-1 Receptor-associated Kinase 2; MGC150550; anti-IRAK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3H1
Specificity
Recognizes IRAK2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-IRAK2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
IRAK2 (NP_001561, 111aa-210aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(IRAK2 monoclonal antibody (M03), clone 3H1 Western Blot analysis of IRAK2 expression in HeLa.)

Western Blot (WB) (IRAK2 monoclonal antibody (M03), clone 3H1 Western Blot analysis of IRAK2 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged IRAK2 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IRAK2 is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-IRAK2 antibody
IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of NF-kappaB. [provided by RefSeq]
Product Categories/Family for anti-IRAK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69,433 Da
NCBI Official Full Name
interleukin-1 receptor-associated kinase-like 2
NCBI Official Synonym Full Names
interleukin-1 receptor-associated kinase 2
NCBI Official Symbol
IRAK2
NCBI Official Synonym Symbols
IRAK-2
NCBI Protein Information
interleukin-1 receptor-associated kinase-like 2; interleukin-1 receptor associated kinase-2
UniProt Protein Name
Interleukin-1 receptor-associated kinase-like 2
UniProt Gene Name
IRAK2
UniProt Synonym Gene Names
IRAK-2
UniProt Entry Name
IRAK2_HUMAN

Uniprot Description

IRAK2: Binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization. Interacts with MYD88. IL-1 stimulation leads to the formation of a signaling complex which dissociates from the IL-1 receptor following the binding of PELI1. Expressed in spleen, thymus, prostate, lung, liver, skeletal muscle, kidney, pancreas and peripheral blood leukocytes. Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily.

Protein type: Protein kinase, Ser/Thr (non-receptor); Protein kinase, TKL; Kinase, protein; TKL group; IRAK family

Chromosomal Location of Human Ortholog: 3p25.3

Cellular Component: interleukin-1 receptor complex; cytoplasm; plasma membrane; endosome membrane; cytosol; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; protein homodimerization activity; protein heterodimerization activity; ATP binding

Biological Process: I-kappaB kinase/NF-kappaB cascade; activation of MAPK activity; MyD88-independent toll-like receptor signaling pathway; stress-activated MAPK cascade; toll-like receptor 3 signaling pathway; protein amino acid phosphorylation; activation of NF-kappaB transcription factor; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; toll-like receptor 5 signaling pathway; inhibition of NF-kappaB transcription factor; lipopolysaccharide-mediated signaling pathway; toll-like receptor signaling pathway; innate immune response; regulation of cytokine and chemokine mediated signaling pathway; JNK cascade; toll-like receptor 9 signaling pathway; inflammatory response; toll-like receptor 4 signaling pathway

Similar Products

Product Notes

The IRAK2 irak2 (Catalog #AAA6161620) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IRAK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IRAK2 irak2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IRAK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.