Mouse anti-Human ZNF197 Monoclonal Antibody | anti-ZNF197 antibody

ZNF197 (Zinc Finger Protein 197, pVHL-associated KRAB Domain-containing Protein, Zinc Finger Protein with KRAB and SCAN Domains 9, ZKSCAN9, ZnF20, ZNF166, D3S1363E, P18, VHLaK, ZSCAN41) (PE)

Cat. Num. AAA6161162

• Gene Names: ZNF197; P18; VHLaK; ZNF20; ZNF166; ZKSCAN9; ZSCAN41; D3S1363E
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ZNF197; Monoclonal Antibody; ZNF197 (Zinc Finger Protein 197; pVHL-associated KRAB Domain-containing Protein; Zinc Finger Protein with KRAB and SCAN Domains 9; ZKSCAN9; ZnF20; ZNF166; D3S1363E; P18; VHLaK; ZSCAN41) (PE); anti-ZNF197 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3C11
• Specificity: Recognizes human ZNF197.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 2948

• Applicable Applications for anti-ZNF197 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: ELISA: 1 ng/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa161-267 from ZNF197 (NP_001020026) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IAAEICPHPPTDLVAFNLQDPQHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRALYWDVMLENYGNVTSLGYRKYRRQRNK
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.88kD).)

Testing Data

(Detection limit for recombinant GST tagged ZNF197 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-ZNF197 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 1676324735
• NCBI GeneID: 10168
• NCBI Accession #: NM_001024855.3
• NCBI GenBank Nucleotide #: NM_001024855
• NCBI Official Full Name: Homo sapiens zinc finger protein 197 (ZNF197), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: zinc finger protein 197
• NCBI Official Symbol: ZNF197
• NCBI Official Synonym Symbols: P18; VHLaK; ZNF20; ZNF166; ZKSCAN9; ZSCAN41; D3S1363E
• NCBI Protein Information: zinc finger protein 197
• Protein Family: Zinc finger protein

NCBI Description

This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Naturally-occurring readthrough transcription is observed between this gene and the upstream zinc finger protein 660 gene and is represented by GeneID:110354863. [provided by RefSeq, May 2017]