Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.88kD).)

Mouse anti-Human ZNF197 Monoclonal Antibody | anti-ZNF197 antibody

ZNF197 (Zinc Finger Protein 197, pVHL-associated KRAB Domain-containing Protein, Zinc Finger Protein with KRAB and SCAN Domains 9, ZKSCAN9, ZnF20, ZNF166, D3S1363E, P18, VHLaK, ZSCAN41) APC

Gene Names
ZNF197; P18; VHLaK; ZNF20; ZNF166; ZKSCAN9; ZSCAN41; D3S1363E
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZNF197; Monoclonal Antibody; ZNF197 (Zinc Finger Protein 197; pVHL-associated KRAB Domain-containing Protein; Zinc Finger Protein with KRAB and SCAN Domains 9; ZKSCAN9; ZnF20; ZNF166; D3S1363E; P18; VHLaK; ZSCAN41) APC; anti-ZNF197 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C11
Specificity
Recognizes human ZNF197.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2948
Applicable Applications for anti-ZNF197 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
ELISA: 1 ng/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa161-267 from ZNF197 (NP_001020026) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IAAEICPHPPTDLVAFNLQDPQHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRALYWDVMLENYGNVTSLGYRKYRRQRNK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.88kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.88kD).)

Testing Data

(Detection limit for recombinant GST tagged ZNF197 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZNF197 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-ZNF197 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens zinc finger protein 197 (ZNF197), transcript variant 2, mRNA
NCBI Official Synonym Full Names
zinc finger protein 197
NCBI Official Symbol
ZNF197
NCBI Official Synonym Symbols
P18; VHLaK; ZNF20; ZNF166; ZKSCAN9; ZSCAN41; D3S1363E
NCBI Protein Information
zinc finger protein 197
Protein Family

NCBI Description

This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Naturally-occurring readthrough transcription is observed between this gene and the upstream zinc finger protein 660 gene and is represented by GeneID:110354863. [provided by RefSeq, May 2017]

Research Articles on ZNF197

Similar Products

Product Notes

The ZNF197 (Catalog #AAA6139950) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF197 (Zinc Finger Protein 197, pVHL-associated KRAB Domain-containing Protein, Zinc Finger Protein with KRAB and SCAN Domains 9, ZKSCAN9, ZnF20, ZNF166, D3S1363E, P18, VHLaK, ZSCAN41) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF197 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). ELISA: 1 ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZNF197 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF197, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.