Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Mouse anti-Human SLC26A5 Monoclonal Antibody | anti-SLC26A5 antibody

SLC26A5 (Solute Carrier Family 26 Member 5, DFNB61, Prestin, PRES) (PE)

Gene Names
SLC26A5; PRES; DFNB61
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC26A5; Monoclonal Antibody; SLC26A5 (Solute Carrier Family 26 Member 5; DFNB61; Prestin; PRES) (PE); MGC118886; MGC118887; MGC118888; MGC118889; anti-SLC26A5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F4
Specificity
Recognizes human SLC26A5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SLC26A5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~1ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa645-742 from human SLC26A5 (NP_945350) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLGSQLREALAEQEASAPPSQEDLEPNATPAT*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Testing Data

(Detection limit for recombinant GST tagged SLC26A5 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC26A5 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-SLC26A5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Full Name
prestin isoform a
NCBI Official Synonym Full Names
solute carrier family 26 member 5
NCBI Official Symbol
SLC26A5
NCBI Official Synonym Symbols
PRES; DFNB61
NCBI Protein Information
prestin
UniProt Protein Name
Prestin
Protein Family
UniProt Gene Name
SLC26A5
UniProt Synonym Gene Names
PRES

NCBI Description

This gene encodes a member of the SLC26A/SulP transporter family. The protein functions as a molecular motor in motile outer hair cells (OHCs) of the cochlea, inducing changes in cell length that act to amplify sound levels. The transmembrane protein is an incomplete anion transporter, and does not allow anions to cross the cell membrane but instead undergoes a conformational change in response to changes in intracellular Cl- levels that results in a change in cell length. The protein functions at microsecond rates, which is several orders of magnitude faster than conventional molecular motor proteins. Mutations in this gene are potential candidates for causing neurosensory deafness. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Nov 2009]

Uniprot Description

SLC26A5: Motor protein that converts auditory stimuli to length changes in outer hair cells and mediates sound amplification in the mammalian hearing organ. Prestin is a bidirectional voltage- to-force converter, it can operate at microsecond rates. It uses cytoplasmic anions as extrinsic voltage sensors, probably chloride and bicarbonate. After binding to a site with millimolar affinity, these anions are translocated across the membrane in response to changes in the transmembrane voltage. They move towards the extracellular surface following hyperpolarization, and towards the cytoplasmic side in response to depolarization. As a consequence, this translocation triggers conformational changes in the protein that ultimately alter its surface area in the plane of the plasma membrane. The area decreases when the anion is near the cytoplasmic face of the membrane (short state), and increases when the ion has crossed the membrane to the outer surface (long state). So, it acts as an incomplete transporter. It swings anions across the membrane, but does not allow these anions to dissociate and escape to the extracellular space. Salicylate, an inhibitor of outer hair cell motility, acts as competitive antagonist at the prestin anion-binding site. Defects in SLC26A5 are the cause of deafness autosomal recessive type 61 (DFNB61). A form of non-syndromic sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Belongs to the SLC26A/SulP transporter (TC 2.A.53) family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter; Transporter, SLC family

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: basolateral plasma membrane; cytoplasm; integral component of plasma membrane; lateral plasma membrane

Molecular Function: anion:anion antiporter activity; bicarbonate transmembrane transporter activity; chloride channel activity; oxalate transmembrane transporter activity; protein homodimerization activity; secondary active sulfate transmembrane transporter activity; spectrin binding; sulfate transmembrane transporter activity; transcription factor binding

Biological Process: bicarbonate transport; fructose transport; oxalate transport; positive regulation of cell size; protein tetramerization; regulation of cell shape; regulation of intracellular pH; regulation of membrane potential; response to drug; response to salicylic acid; sensory perception of sound

Research Articles on SLC26A5

Similar Products

Product Notes

The SLC26A5 slc26a5 (Catalog #AAA6160326) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC26A5 (Solute Carrier Family 26 Member 5, DFNB61, Prestin, PRES) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC26A5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~1ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC26A5 slc26a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC26A5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.