Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human, Mouse RFWD2 Monoclonal Antibody | anti-RFWD2 antibody

RFWD2 (E3 Ubiquitin-protein Ligase RFWD2, RING Finger and WD Repeat Domain Protein 2, Constitutive Photomorphogenesis Protein 1 Homolog, hCOP1, RING Finger Protein 200, COP1, RNF200, FLJ10416) (PE)

Gene Names
COP1; RFWD2; RNF200
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RFWD2; Monoclonal Antibody; RFWD2 (E3 Ubiquitin-protein Ligase RFWD2; RING Finger and WD Repeat Domain Protein 2; Constitutive Photomorphogenesis Protein 1 Homolog; hCOP1; RING Finger Protein 200; COP1; RNF200; FLJ10416) (PE); anti-RFWD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1E4
Specificity
Recognizes human RFWD2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RFWD2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa632-731 of human RFWD2 (NP_071902) with GST tag (MW of the GST tag alone is 26kD).
Immunogen Sequence
CLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of RFWD2 expression in NIH/3T3.)

Western Blot (WB) (Western Blot analysis of RFWD2 expression in NIH/3T3.)

Immunofluorescence (IF)

(Immunofluorescence analysis of RFWD2 in NIH/3T3 cells.)

Immunofluorescence (IF) (Immunofluorescence analysis of RFWD2 in NIH/3T3 cells.)

Testing Data

(Detection limit for recombinant GST tagged RFWD2 is ~0.1ng/ml using antibody MBS649164 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RFWD2 is ~0.1ng/ml using antibody MBS649164 as a capture antibody.)
Product Categories/Family for anti-RFWD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,914 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RFWD2 isoform a
NCBI Official Synonym Full Names
COP1, E3 ubiquitin ligase
NCBI Official Symbol
COP1
NCBI Official Synonym Symbols
RFWD2; RNF200
NCBI Protein Information
E3 ubiquitin-protein ligase RFWD2
UniProt Protein Name
E3 ubiquitin-protein ligase RFWD2
UniProt Gene Name
RFWD2
UniProt Synonym Gene Names
COP1; RNF200; hCOP1
UniProt Entry Name
RFWD2_HUMAN

Uniprot Description

COP1: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin- conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in JUN ubiquitination and degradation. Directly involved in p53 (TP53) ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. Ubiquitinates p53 independently of MDM2 or RCHY1. Probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, the ubiquitin ligase activity being mediated by RBX1. Homodimer. Homodimerization is mediated by the coiled coil domain. Component of the DCX DET1-COP1 ubiquitin ligase complex at least composed of RBX1, DET1, DDB1, CUL4A and COP1. Isoform 2 does not interact with CUL4A but still binds to RBX1, suggesting that the interaction may be mediated by another culllin protein. Isoform 1 and isoform 2 interact with CUL5 but not with CUL1, CUL2 not CUL3. Interacts with bZIP transcription factors JUN, JUNB and JUND but not with FOS, ATF2 nor XBP1. Interacts with p53 (TP53). By p53/TP53. Ubiquitously expressed at low level. Expressed at higher level in testis, placenta, skeletal muscle and heart. Belongs to the COP1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; Ubiquitin conjugating system; Ligase; EC 6.3.2.19; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 1q25.1-q25.2

Cellular Component: Golgi membrane; nucleoplasm; centrosome; focal adhesion; cytoplasm; nuclear speck; cytosol

Molecular Function: protein binding; zinc ion binding; ligase activity

Biological Process: positive regulation of proteasomal ubiquitin-dependent protein catabolic process; protein ubiquitination; response to ionizing radiation; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest

Research Articles on RFWD2

Similar Products

Product Notes

The RFWD2 rfwd2 (Catalog #AAA6159911) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RFWD2 (E3 Ubiquitin-protein Ligase RFWD2, RING Finger and WD Repeat Domain Protein 2, Constitutive Photomorphogenesis Protein 1 Homolog, hCOP1, RING Finger Protein 200, COP1, RNF200, FLJ10416) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RFWD2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RFWD2 rfwd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RFWD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.