Mouse anti-Human, Mouse RFWD2 Monoclonal Antibody | anti-RFWD2 antibody

RFWD2 (E3 Ubiquitin-protein Ligase RFWD2, RING Finger and WD Repeat Domain Protein 2, Constitutive Photomorphogenesis Protein 1 Homolog, hCOP1, RING Finger Protein 200, COP1, RNF200, FLJ10416) (HRP)

Cat. Num. AAA6154608

• Gene Names: COP1; RFWD2; RNF200
• Reactivity: Human, Mouse
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RFWD2; Monoclonal Antibody; RFWD2 (E3 Ubiquitin-protein Ligase RFWD2; RING Finger and WD Repeat Domain Protein 2; Constitutive Photomorphogenesis Protein 1 Homolog; hCOP1; RING Finger Protein 200; COP1; RNF200; FLJ10416) (HRP); anti-RFWD2 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1E4
• Specificity: Recognizes human RFWD2. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-RFWD2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa632-731 of human RFWD2 (NP_071902) with GST tag (MW of the GST tag alone is 26kD).
• Immunogen Sequence: CLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of RFWD2 expression in NIH/3T3.)

Immunofluorescence (IF)

(Immunofluorescence analysis of RFWD2 in NIH/3T3 cells.)

Testing Data

(Detection limit for recombinant GST tagged RFWD2 is ~0.1ng/ml using antibody MBS649164 as a capture antibody.)

Related Product Information for anti-RFWD2 antibody

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in JUN ubiquitination and degradation. Directly involved in p53 (TP53) ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. Ubiquitinates p53 independently of MDM2 or RCHY1. Probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, the ubiquitin ligase activity being mediated by RBX1. Involved in 14-3-3 protein sigma/SFN ubiquitination and proteasomal degradation, leading to AKT activation and promotion of cell survival.

Product Categories/Family for anti-RFWD2 antibody

Antibodies; WD Repeat Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21359963
• NCBI GeneID: 64326
• NCBI Accession #: NP_071902
• NCBI GenBank Nucleotide #: NM_022457
• UniProt Accession #: Q8NHY2; Q504W6; Q6H103; Q9H6L7; E9PKI0; X5D9B4
• Molecular Weight: 14,914 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase RFWD2 isoform a
• NCBI Official Synonym Full Names: COP1, E3 ubiquitin ligase
• NCBI Official Symbol: COP1
• NCBI Official Synonym Symbols: RFWD2; RNF200
• NCBI Protein Information: E3 ubiquitin-protein ligase RFWD2
• UniProt Protein Name: E3 ubiquitin-protein ligase RFWD2
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: RFWD2
• UniProt Synonym Gene Names: COP1; RNF200; hCOP1
• UniProt Entry Name: RFWD2_HUMAN

Uniprot Description

COP1: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin- conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in JUN ubiquitination and degradation. Directly involved in p53 (TP53) ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. Ubiquitinates p53 independently of MDM2 or RCHY1. Probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, the ubiquitin ligase activity being mediated by RBX1. Homodimer. Homodimerization is mediated by the coiled coil domain. Component of the DCX DET1-COP1 ubiquitin ligase complex at least composed of RBX1, DET1, DDB1, CUL4A and COP1. Isoform 2 does not interact with CUL4A but still binds to RBX1, suggesting that the interaction may be mediated by another culllin protein. Isoform 1 and isoform 2 interact with CUL5 but not with CUL1, CUL2 not CUL3. Interacts with bZIP transcription factors JUN, JUNB and JUND but not with FOS, ATF2 nor XBP1. Interacts with p53 (TP53). By p53/TP53. Ubiquitously expressed at low level. Expressed at higher level in testis, placenta, skeletal muscle and heart. Belongs to the COP1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; Ubiquitin conjugating system; Ligase; EC 6.3.2.19; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 1q25.1-q25.2

Cellular Component: Golgi membrane; nucleoplasm; centrosome; focal adhesion; cytoplasm; nuclear speck; cytosol

Molecular Function: protein binding; zinc ion binding; ligase activity

Biological Process: positive regulation of proteasomal ubiquitin-dependent protein catabolic process; protein ubiquitination; response to ionizing radiation; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest