Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PLXNC1 is ~1ng/ml as a capture antibody.)

Mouse anti-Human PLXNC1 Monoclonal Antibody | anti-PLXNC1 antibody

PLXNC1 (VESPR, Plexin-C1, Virus-encoded Semaphorin Protein Receptor, CD232) (PE)

Gene Names
PLXNC1; CD232; VESPR; PLXN-C1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PLXNC1; Monoclonal Antibody; PLXNC1 (VESPR; Plexin-C1; Virus-encoded Semaphorin Protein Receptor; CD232) (PE); anti-PLXNC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1A12
Specificity
Recognizes human PLXNC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1568
Applicable Applications for anti-PLXNC1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa250-348 from PLXNC1 (NP_005752) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PYNYTSGAATGWPSMARIAQSTEVLFQGQASLDCGHGHPDGRRLLLSSSLVEALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFK
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PLXNC1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PLXNC1 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-PLXNC1 antibody
PLXNC1 is a receptor for vaccinia virus semaphorin A39R and for Herpes virus Sema protein. Binding of viral semaphorins triggers cellular responses leading to the rearrangement of the cytoskeleton and to secretion of IL6 and IL8 (By similarity).
Product Categories/Family for anti-PLXNC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
plexin-C1
NCBI Official Synonym Full Names
plexin C1
NCBI Official Symbol
PLXNC1
NCBI Official Synonym Symbols
CD232; VESPR; PLXN-C1
NCBI Protein Information
plexin-C1
UniProt Protein Name
Plexin-C1
Protein Family
UniProt Gene Name
PLXNC1
UniProt Synonym Gene Names
VESPR

NCBI Description

This gene encodes a member of the plexin family. Plexins are transmembrane receptors for semaphorins, a large family of proteins that regulate axon guidance, cell motility and migration, and the immune response. The encoded protein and its ligand regulate melanocyte adhesion, and viral semaphorins may modulate the immune response by binding to this receptor. The encoded protein may be a tumor suppressor protein for melanoma. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

Receptor for SEMA7A, for smallpox semaphorin A39R, vaccinia virus semaphorin A39R and for herpesvirus Sema protein. Binding of semaphorins triggers cellular responses leading to the rearrangement of the cytoskeleton and to secretion of IL6 and IL8 ().

Research Articles on PLXNC1

Similar Products

Product Notes

The PLXNC1 plxnc1 (Catalog #AAA6159535) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PLXNC1 (VESPR, Plexin-C1, Virus-encoded Semaphorin Protein Receptor, CD232) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLXNC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLXNC1 plxnc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLXNC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.