Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human PIGQ Monoclonal Antibody | anti-PIGQ antibody

PIGQ (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit Q, N-acetylglucosamyl Transferase Component GPI1, Phosphatidylinositol-glycan Biosynthesis Class Q Protein, PIG-Q, GPI1, c407A10.1, hGPI1, MGC12693) (PE)

Gene Names
PIGQ; GPI1; c407A10.1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIGQ; Monoclonal Antibody; PIGQ (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit Q; N-acetylglucosamyl Transferase Component GPI1; Phosphatidylinositol-glycan Biosynthesis Class Q Protein; PIG-Q; GPI1; c407A10.1; hGPI1; MGC12693) (PE); anti-PIGQ antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B7
Specificity
Recognizes human PIGQ.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PIGQ antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 4ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa661-759 from PIGQ (NP_683721) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HCPMPTLCTQVQRVRPPQQPQVEGWSPWGLPSGSALAVGVEGPCQDEPPSPRHPLAPSAEQHPASGGLKQSLTPVPSGPGPSLPEPHGVYLRMFPGEV
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(Western Blot analysis of PIGQ expression in transfected 293T cell line by PIGQ monoclonal antibody. Lane 1: PIGQ transfected lysate (84.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PIGQ expression in transfected 293T cell line by PIGQ monoclonal antibody. Lane 1: PIGQ transfected lysate (84.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PIGQ on formalin-fixed paraffin-embedded human placenta. [antibody concentration 4ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PIGQ on formalin-fixed paraffin-embedded human placenta. [antibody concentration 4ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PIGQ is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PIGQ is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-PIGQ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
phosphatidylinositol N-acetylglucosaminyltransferase subunit Q isoform 1
NCBI Official Synonym Full Names
phosphatidylinositol glycan anchor biosynthesis class Q
NCBI Official Symbol
PIGQ
NCBI Official Synonym Symbols
GPI1; c407A10.1
NCBI Protein Information
phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
UniProt Protein Name
Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
UniProt Gene Name
PIGQ
UniProt Synonym Gene Names
GPI1; PIG-Q
UniProt Entry Name
PIGQ_HUMAN

NCBI Description

This gene is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2012]

Research Articles on PIGQ

Similar Products

Product Notes

The PIGQ pigq (Catalog #AAA6159462) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIGQ (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit Q, N-acetylglucosamyl Transferase Component GPI1, Phosphatidylinositol-glycan Biosynthesis Class Q Protein, PIG-Q, GPI1, c407A10.1, hGPI1, MGC12693) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIGQ can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 4ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIGQ pigq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIGQ, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.