Mouse anti-Human, Rat PAX9 Monoclonal Antibody | anti-PAX9 antibody

PAX9 (Paired Box Protein Pax-9) (PE)

Cat. Num. AAA6159294

• Gene Names: PAX9; STHAG3
• Reactivity: Human, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PAX9; Monoclonal Antibody; PAX9 (Paired Box Protein Pax-9) (PE); anti-PAX9 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4B9
• Specificity: Recognizes human PAX9. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-PAX9 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa205-300 from human PAX9 (NP_006185) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.56kD).)

Western Blot (WB)

(PAX9 monoclonal antibody. Western Blot analysis of PAX9 expression in PC-12.)

Western Blot (WB)

(PAX9 monoclonal antibody Western Blot analysis of PAX9 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of PAX9 expression in transfected 293T cell line by PAX9 monoclonal antibody. Lane 1: PAX9 transfected lysate (36.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of PAX9 over-expressed 293 cell line, cotransfected with PAX9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PAX9 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-PAX9 antibody

This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 9 gene is unknown but it may involve development of stratified squamous epithelia as well as various organs and skeletal elements. [provided by RefSeq]

Product Categories/Family for anti-PAX9 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 7242167
• NCBI GeneID: 5083
• NCBI Accession #: NP_006185
• NCBI GenBank Nucleotide #: NM_006194
• UniProt Accession #: P55771; Q99582; Q9UQR4
• Molecular Weight: 38.7 kDa (364aa)
• NCBI Official Full Name: paired box protein Pax-9
• NCBI Official Synonym Full Names: paired box 9
• NCBI Official Symbol: PAX9
• NCBI Official Synonym Symbols: STHAG3
• NCBI Protein Information: paired box protein Pax-9
• UniProt Protein Name: Paired box protein Pax-9
• Protein Family: Paired box protein
• UniProt Gene Name: PAX9
• UniProt Entry Name: PAX9_HUMAN

NCBI Description

This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. Mice lacking this gene exhibit impaired development of organs, musculature and the skeleton, including absent and abnormally developed teeth, and neonatal lethality. Mutations in the human gene are associated with selective tooth agenesis-3. [provided by RefSeq, Sep 2015]

Uniprot Description

PAX9: Transcription factor required for normal development of thymus, parathyroid glands, ultimobranchial bodies, teeth, skeletal elements of skull and larynx as well as distal limbs. Interacts with KDM5B.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 14q13.3

Cellular Component: nucleus

Molecular Function: protein binding

Biological Process: odontogenesis; transcription, DNA-dependent; regulation of odontogenesis; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; endoderm development

Disease: Tooth Agenesis, Selective, 3