Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.56kD).)

Mouse anti-Human, Rat PAX9 Monoclonal Antibody | anti-PAX9 antibody

PAX9 (Paired Box Protein Pax-9) (AP)

Gene Names
PAX9; STHAG3
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAX9; Monoclonal Antibody; PAX9 (Paired Box Protein Pax-9) (AP); anti-PAX9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B9
Specificity
Recognizes human PAX9. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PAX9 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa205-300 from human PAX9 (NP_006185) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.56kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.56kD).)

Western Blot (WB)

(PAX9 monoclonal antibody. Western Blot analysis of PAX9 expression in PC-12.)

Western Blot (WB) (PAX9 monoclonal antibody. Western Blot analysis of PAX9 expression in PC-12.)

Western Blot (WB)

(PAX9 monoclonal antibody Western Blot analysis of PAX9 expression in Hela NE.)

Western Blot (WB) (PAX9 monoclonal antibody Western Blot analysis of PAX9 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of PAX9 expression in transfected 293T cell line by PAX9 monoclonal antibody. Lane 1: PAX9 transfected lysate (36.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PAX9 expression in transfected 293T cell line by PAX9 monoclonal antibody. Lane 1: PAX9 transfected lysate (36.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of PAX9 over-expressed 293 cell line, cotransfected with PAX9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PAX9 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PAX9 over-expressed 293 cell line, cotransfected with PAX9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PAX9 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-PAX9 antibody
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 9 gene is unknown but it may involve development of stratified squamous epithelia as well as various organs and skeletal elements. [provided by RefSeq]
Product Categories/Family for anti-PAX9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38.7 kDa (364aa)
NCBI Official Full Name
paired box protein Pax-9
NCBI Official Synonym Full Names
paired box 9
NCBI Official Symbol
PAX9
NCBI Official Synonym Symbols
STHAG3
NCBI Protein Information
paired box protein Pax-9
UniProt Protein Name
Paired box protein Pax-9
Protein Family
UniProt Gene Name
PAX9
UniProt Entry Name
PAX9_HUMAN

NCBI Description

This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. Mice lacking this gene exhibit impaired development of organs, musculature and the skeleton, including absent and abnormally developed teeth, and neonatal lethality. Mutations in the human gene are associated with selective tooth agenesis-3. [provided by RefSeq, Sep 2015]

Uniprot Description

PAX9: Transcription factor required for normal development of thymus, parathyroid glands, ultimobranchial bodies, teeth, skeletal elements of skull and larynx as well as distal limbs. Interacts with KDM5B.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 14q13.3

Cellular Component: nucleus

Molecular Function: protein binding

Biological Process: odontogenesis; transcription, DNA-dependent; regulation of odontogenesis; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; endoderm development

Disease: Tooth Agenesis, Selective, 3

Research Articles on PAX9

Similar Products

Product Notes

The PAX9 pax9 (Catalog #AAA6132779) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PAX9 (Paired Box Protein Pax-9) (AP) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PAX9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAX9 pax9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAX9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.