Mouse anti-Human TMPRSS5 Monoclonal Antibody | anti-TMPRSS5 antibody

TMPRSS5 (Transmembrane Protease Serine 5, Spinesin)

Cat. Num. AAA645947

• Gene Names: TMPRSS5; SPINESIN
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: TMPRSS5; Monoclonal Antibody; TMPRSS5 (Transmembrane Protease Serine 5; Spinesin); Anti -TMPRSS5 (Transmembrane Protease Serine 5; anti-TMPRSS5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2E5
• Specificity: Recognizes human TMPRSS5.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: HCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHTHPSHTYS

• Applicable Applications for anti-TMPRSS5 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa258-358 from human TMPRSS5 (NP_110397) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TMPRSS5 monoclonal antibody. Western Blot analysis of TMPRSS5 expression in human kidney.)

Testing Data

(Detection limit for recombinant GST tagged TMPRSS5 is 3ng/ml as a capture antibody.)

Product Categories/Family for anti-TMPRSS5 antibody

Antibodies; Abs to Enzymes; Protease (Proteinase; Peptidase)

NCBI and Uniprot Product Information

• NCBI GI #: 170932492
• NCBI GeneID: 80975
• NCBI Accession #: NP_110397.2
• NCBI GenBank Nucleotide #: NM_030770.2
• UniProt Accession #: Q9H3S3
• Molecular Weight: 49,560 Da
• NCBI Official Full Name: transmembrane protease serine 5
• NCBI Official Synonym Full Names: transmembrane protease, serine 5
• NCBI Official Symbol: TMPRSS5
• NCBI Official Synonym Symbols: SPINESIN
• NCBI Protein Information: transmembrane protease serine 5
• UniProt Protein Name: Transmembrane protease serine 5
• Protein Family: Transmembrane protease serine
• UniProt Gene Name: TMPRSS5
• UniProt Entry Name: TMPS5_HUMAN

NCBI Description

This gene encodes a protein that belongs to the serine protease family. Serine proteases are known to be involved in many physiological and pathological processes. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May play a role in hearing. Ref.3

Subcellular location: Cell membrane; Single-pass type II membrane protein

Potential Ref.3.

Tissue specificity: Brain-specific. Predominantly expressed in neurons, in their axons, and at the synapses of motoneurons in the spinal cord.

Involvement in disease: Defects in TMPRSS5 may be a cause of deafness.

Sequence similarities: Belongs to the peptidase S1 family.Contains 1 peptidase S1 domain.Contains 1 SRCR domain.