Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human NIT1 Monoclonal Antibody | anti-NIT1 antibody

NIT1 (Nitrilase Homolog 1, MGC57670) (PE)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NIT1; Monoclonal Antibody; NIT1 (Nitrilase Homolog 1; MGC57670) (PE); anti-NIT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C3
Specificity
Recognizes human NIT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-NIT1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa228-328 from human NIT1 (NP_005591) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGTVVARCSEGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of NIT1 expression in transfected 293T cell line by NIT1 monoclonal antibody. Lane 1: NIT1 transfected lysate (Predicted MW: 35.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NIT1 expression in transfected 293T cell line by NIT1 monoclonal antibody. Lane 1: NIT1 transfected lysate (Predicted MW: 35.9kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of NIT1 transfected lysate using NIT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NIT1 monoclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of NIT1 transfected lysate using NIT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NIT1 monoclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged NIT1 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NIT1 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-NIT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,326 Da
NCBI Official Full Name
nitrilase homolog 1 isoform 1
NCBI Official Synonym Full Names
nitrilase 1
NCBI Official Symbol
NIT1
NCBI Protein Information
nitrilase homolog 1
UniProt Protein Name
Nitrilase homolog 1
Protein Family
UniProt Gene Name
NIT1
UniProt Entry Name
NIT1_HUMAN

NCBI Description

This gene encodes a member of the nitrilase protein family with homology to bacterial and plant nitrilases, enzymes that cleave nitriles and organic amides to the corresponding carboxylic acids plus ammonia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

NIT1: Plays a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. Has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tumor suppressor activity of FHIT. It is also a negative regulator of primary T-cells. Has apparently no omega-amidase activity such as NIT2. Belongs to the UPF0012 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.5.-.-; Hydrolase

Chromosomal Location of Human Ortholog: 1q21-q22

Cellular Component: mitochondrion; nucleus

Molecular Function: nitrilase activity

Biological Process: nitrogen compound metabolic process

Research Articles on NIT1

Similar Products

Product Notes

The NIT1 nit1 (Catalog #AAA6159098) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NIT1 (Nitrilase Homolog 1, MGC57670) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NIT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NIT1 nit1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NIT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.