Mouse anti-Human MLK3 Monoclonal Antibody | anti-MLK3 antibody

MLK3 (Mixed Lineage Kinase 3, MLK-3, Mitogen-activated Protein Kinase Kinase Kinase 11, MAP3K11, MEKK11, PTK1, Src-homology 3 Domain-containing Proline-rich Kinase, SPRK, MGC17114) (PE)

Cat. Num. AAA6158849

• Gene Names: MAP3K11; MLK3; PTK1; SPRK; MLK-3; MEKK11
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MLK3; Monoclonal Antibody; MLK3 (Mixed Lineage Kinase 3; MLK-3; Mitogen-activated Protein Kinase Kinase Kinase 11; MAP3K11; MEKK11; PTK1; Src-homology 3 Domain-containing Proline-rich Kinase; SPRK; MGC17114) (PE); anti-MLK3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3D11
• Specificity: Recognizes human MAP3K11.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-MLK3 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa741-847 from human MAP3K11 (NP_002410) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGP
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.51kD).)

Western Blot (WB)

(Western Blot analysis of MAP3K11 expression in transfected 293T cell line by MAP3K11 monoclonal antibody. Lane 1: MAP3K11 transfected lysate (92.7kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MAP3K11 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MAP3K11 is 0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between CDC42 and MAP3K11 HeLa cells were stained with anti-CDC42 rabbit purified polyclonal 1:1200 and anti-MAP3K11 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Product Categories/Family for anti-MLK3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4505195
• NCBI GeneID: 4296
• NCBI Accession #: NP_002410
• NCBI GenBank Nucleotide #: NM_002419
• UniProt Accession #: Q16584
• Molecular Weight: 93kDa
• NCBI Official Full Name: mitogen-activated protein kinase kinase kinase 11
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase kinase 11
• NCBI Official Symbol: MAP3K11
• NCBI Official Synonym Symbols: MLK3; PTK1; SPRK; MLK-3; MEKK11
• NCBI Protein Information: mitogen-activated protein kinase kinase kinase 11
• UniProt Protein Name: Mitogen-activated protein kinase kinase kinase 11
• UniProt Gene Name: MAP3K11
• UniProt Entry Name: M3K11_HUMAN

NCBI Description

The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase contains a SH3 domain and a leucine zipper-basic motif. This kinase preferentially activates MAPK8/JNK kinase, and functions as a positive regulator of JNK signaling pathway. This kinase can directly phosphorylate, and activates IkappaB kinase alpha and beta, and is found to be involved in the transcription activity of NF-kappaB mediated by Rho family GTPases and CDC42. [provided by RefSeq, Jul 2008]

Uniprot Description

MLK3: a TKL kinase of the MLK family. Has an amino-terminal SH3 domain followed by the kinase domain, two leucine zipper domains, a cdc42/Rac1 binding (CRIB) domain and several other domains/motifs at the carboxy-terminal region. Phosphorylates IkappaB and activates SEK1 and MKK7.

Protein type: EC 2.7.11.25; Kinase, protein; Protein kinase, TKL; Protein kinase, Ser/Thr (non-receptor); TKL group; MLK family; MLK subfamily

Chromosomal Location of Human Ortholog: 11q13.1-q13.3

Cellular Component: centrosome; cytoplasm; membrane; microtubule

Molecular Function: ATP binding; identical protein binding; JUN kinase kinase kinase activity; mitogen-activated protein kinase kinase binding; mitogen-activated protein kinase kinase kinase binding; protein binding; protein homodimerization activity; protein kinase activity; protein serine/threonine kinase activity; protein-tyrosine kinase activity; Rac GTPase binding

Biological Process: activation of JNK activity; activation of JNKK activity; activation of MAPK activity; cell death; cell proliferation; JNK cascade; microtubule-based process; peptidyl-tyrosine phosphorylation; positive regulation of JNK activity; positive regulation of JNK cascade; positive regulation of neuron apoptosis; protein amino acid autophosphorylation; protein amino acid phosphorylation