Mouse anti-Human LLGL2 Monoclonal Antibody | anti-LLGL2 antibody

LLGL2 (Lethal(2) Giant Larvae Protein Homolog 2, HGL) (PE)

Cat. Num. AAA6158629

• Gene Names: LLGL2; HGL; LGL2; Hugl-2
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LLGL2; Monoclonal Antibody; LLGL2 (Lethal(2) Giant Larvae Protein Homolog 2; HGL) (PE); anti-LLGL2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G2
• Specificity: Recognizes human LLGL2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1015

• Applicable Applications for anti-LLGL2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa101-199 from human LLGL2 (NP_004515) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPR
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of LLGL2 expression in transfected 293T cell line by LLGL2 monoclonal antibody. Lane 1: LLGL2 transfected lysate (113kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LLGL2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1ug/ml])

Testing Data

(Detection limit for recombinant GST tagged LLGL2 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-LLGL2 antibody

Antibodies; Proteins

References

1. Loss of Scribble causes cell competition in mammalian cells. Norman M, Wisniewska KA, Lawrenson K, Garcia-Miranda P, Tada M, Kajita M, Mano H, Ishikawa S, Ikegawa M, Shimada T, Fujita Y.J Cell Sci. 2012 Jan 1;125(Pt 1):59-66. Epub 2012 Jan 16. 2. Involvement of Lgl and Mahjong/VprBP in cell competition. Tamori Y, Bialucha CU, Tian AG, Kajita M, Huang YC, Norman M, Harrison N, Poulton J, Ivanovitch K, Disch L, Liu T, Deng WM, Fujita Y.PLoS Biol. 2010 Jul 13;8(7):e1000422. 3. ASPP2 Regulates Epithelial Cell Polarity through the PAR Complex. Cong W, Hirose T, Harita Y, Yamashita A, Mizuno K, Hirano H, Ohno S.Curr Biol. 2010 Jul 7.

NCBI and Uniprot Product Information

• NCBI GI #: 62739161
• NCBI GeneID: 3993
• NCBI Accession #: NP_004515
• NCBI GenBank Nucleotide #: NM_004524
• UniProt Accession #: Q6P1M3
• NCBI Official Full Name: LLGL scribble cell polarity complex component 2 isoform a
• NCBI Official Synonym Full Names: LLGL scribble cell polarity complex component 2
• NCBI Official Symbol: LLGL2
• NCBI Official Synonym Symbols: HGL; LGL2; Hugl-2
• NCBI Protein Information: LLGL scribble cell polarity complex component 2
• UniProt Protein Name: Lethal(2) giant larvae protein homolog 2
• Protein Family: Lethal(2) giant larvae protein
• UniProt Gene Name: LLGL2
• UniProt Entry Name: L2GL2_HUMAN

NCBI Description

The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the protein's ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC). In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]