Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human GATAD2B Monoclonal Antibody | anti-GATAD2B antibody

GATAD2B (Transcriptional Repressor p66-beta, GATA Zinc Finger Domain-containing Protein 2B, p66/p68, KIAA1150, FLJ37346, MGC138257, MGC138285, P66beta, RP11-216N14.6) (PE)

Gene Names
GATAD2B; p68; MRD18; P66beta
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GATAD2B; Monoclonal Antibody; GATAD2B (Transcriptional Repressor p66-beta; GATA Zinc Finger Domain-containing Protein 2B; p66/p68; KIAA1150; FLJ37346; MGC138257; MGC138285; P66beta; RP11-216N14.6) (PE); anti-GATAD2B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G10
Specificity
Recognizes human GATAD2B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GATAD2B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa3-111 from human GATAD2B (NP_065750) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSAR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(GATAD2B monoclonal antibody, Western Blot analysis of GATAD2B expression in Jurkat.)

Western Blot (WB) (GATAD2B monoclonal antibody, Western Blot analysis of GATAD2B expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged GATAD2B is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GATAD2B is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-GATAD2B antibody
Transcriptional repressor. Enhances MBD2-mediated repression. Efficient repression requires the presence of GATAD2A. Targets MBD3 to discrete loci in the nucleus.
Product Categories/Family for anti-GATAD2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
transcriptional repressor p66-beta
NCBI Official Synonym Full Names
GATA zinc finger domain containing 2B
NCBI Official Symbol
GATAD2B
NCBI Official Synonym Symbols
p68; MRD18; P66beta
NCBI Protein Information
transcriptional repressor p66-beta
UniProt Protein Name
Transcriptional repressor p66-beta
Protein Family
UniProt Gene Name
GATAD2B
UniProt Synonym Gene Names
KIAA1150
UniProt Entry Name
P66B_HUMAN

NCBI Description

This gene encodes a zinc finger protein transcriptional repressor. The encoded protein is part of the methyl-CpG-binding protein-1 complex, which represses gene expression by deacetylating methylated nucleosomes. Mutations in this gene are linked to intellectual disability and dysmorphic features associated with cognitive disability. [provided by RefSeq, Jun 2016]

Uniprot Description

GATAD2B: a transcriptional repressor belonging to the MeCP1 histone deacetylase complex. The MeCP1 complex represses transcription through preferential binding, remodeling, and deacetylating methylated nucleosomes.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: nucleoplasm; protein complex; nuclear chromatin; nuclear speck

Molecular Function: nucleosomal DNA binding; zinc ion binding; transcription factor activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; ATP-dependent chromatin remodeling

Disease: Mental Retardation, Autosomal Dominant 18

Research Articles on GATAD2B

Similar Products

Product Notes

The GATAD2B gatad2b (Catalog #AAA6157944) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GATAD2B (Transcriptional Repressor p66-beta, GATA Zinc Finger Domain-containing Protein 2B, p66/p68, KIAA1150, FLJ37346, MGC138257, MGC138285, P66beta, RP11-216N14.6) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GATAD2B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GATAD2B gatad2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GATAD2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.