Mouse anti-Human GADD153 Monoclonal Antibody | anti-GADD153 antibody

GADD153 (DNA Damage-inducible Transcript 3 Protein, DDIT-3, C/EBP-homologous Protein, CHOP, C/EBP-homologous Protein 10, CHOP-10, Growth Arrest and DNA Damage-inducible Protein GADD153, DDIT3, CHOP, CHOP10) (PE)

Cat. Num. AAA6157916

• Gene Names: DDIT3; CHOP; CEBPZ; CHOP10; CHOP-10; GADD153
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GADD153; Monoclonal Antibody; GADD153 (DNA Damage-inducible Transcript 3 Protein; DDIT-3; C/EBP-homologous Protein; CHOP; C/EBP-homologous Protein 10; CHOP-10; Growth Arrest and DNA Damage-inducible Protein GADD153; DDIT3; CHOP10) (PE); anti-GADD153 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2G3
• Specificity: Recognizes human DDIT3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-GADD153 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody.; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-90 from human DDIT3 (AAH03637) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Testing Data

(Detection limit for recombinant GST tagged DDIT3 is ~0.03ng/ml as a capture antibody)

Product Categories/Family for anti-GADD153 antibody

Antibodies; Apoptosis

References

1. Loss of UDP-N-acetylglucosamine 2-epimerase/ N-acetylmannosamine kinase (GNE) induces apoptotic processes in pancreatic carcinoma cells. Kemmner W, Kessel P, Sanchez-Ruderisch H, Moller H, Hinderlich S, Schlag PM, Detjen K.FASEB J. 2011 Nov 2.

NCBI and Uniprot Product Information

• NCBI GI #: 33872688
• NCBI GeneID: 1649
• Molecular Weight: 21,700 Da
• NCBI Official Full Name: Homo sapiens DNA-damage-inducible transcript 3, mRNA
• NCBI Official Synonym Full Names: DNA damage inducible transcript 3
• NCBI Official Symbol: DDIT3
• NCBI Official Synonym Symbols: CHOP; CEBPZ; CHOP10; CHOP-10; GADD153
• NCBI Protein Information: DNA damage-inducible transcript 3 protein

NCBI Description

This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified. [provided by RefSeq, Aug 2010]