<
Western Blot (WB)
(Western Blot detection against immunogen (38.21kD).)
Mouse anti-Human CTHRC1 Monoclonal Antibody | anti-CTHRC1 antibody
CTHRC1 (Protein NMTC1, Collagen Triple Helix Repeat-containing Protein 1, UNQ762/PRO1550) (PE)
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CTHRC1; Monoclonal Antibody; CTHRC1 (Protein NMTC1; Collagen Triple Helix Repeat-containing Protein 1; UNQ762/PRO1550) (PE); anti-CTHRC1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G12
Specificity
Recognizes human CTHRC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CTHRC1 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa32-141 from human CTHRC1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLF
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against immunogen (38.21kD).)
Western Blot (WB)
(Western Blot detection against immunogen (38.21kD).)
Western Blot (WB)
(Western Blot analysis of CTHRC1 expression in transfected 293T cell line by 125444. Lane 1: CTHRC1 transfected lysate (26.2kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CTHRC1 expression in transfected 293T cell line by 125444. Lane 1: CTHRC1 transfected lysate (26.2kD). Lane 2: Non-transfected lysate.)
Immunohistochemistry (IHC)
(Immunoperoxidase on formalin-fixed paraffin-embedded human kidney using 125444 (3ug/ml).)
Immunohistochemistry (IHC)
(Immunoperoxidase on formalin-fixed paraffin-embedded human kidney using 125444 (3ug/ml).)
Testing Data
(Detection limit for 125444 is 0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for 125444 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-CTHRC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Predicted: 27 kDa
Observed: 27 kDa
Observed: 27 kDa
NCBI Official Full Name
collagen triple helix repeat-containing protein 1 isoform 1
NCBI Official Synonym Full Names
collagen triple helix repeat containing 1
NCBI Official Symbol
CTHRC1
NCBI Protein Information
collagen triple helix repeat-containing protein 1
UniProt Protein Name
Collagen triple helix repeat-containing protein 1
Protein Family
UniProt Gene Name
CTHRC1
UniProt Entry Name
CTHR1_HUMAN
NCBI Description
This locus encodes a protein that may play a role in the cellular response to arterial injury through involvement in vascular remodeling. Mutations at this locus have been associated with Barrett esophagus and esophageal adenocarcinoma. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2012]
Research Articles on CTHRC1
Similar Products
Product Notes
The CTHRC1 cthrc1 (Catalog #AAA6157308) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CTHRC1 (Protein NMTC1, Collagen Triple Helix Repeat-containing Protein 1, UNQ762/PRO1550) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTHRC1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CTHRC1 cthrc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CTHRC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
