Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (61.6kD).)

Mouse anti-Human BMI1 Monoclonal Antibody | anti-BMI1 antibody

BMI1 (Polycomb Complex Protein BMI-1, Polycomb Group RING Finger Protein 4, RING Finger Protein 51, PCGF4, RNF51) (PE)

Gene Names
BMI1; PCGF4; RNF51; FLVI2/BMI1; flvi-2/bmi-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BMI1; Monoclonal Antibody; BMI1 (Polycomb Complex Protein BMI-1; Polycomb Group RING Finger Protein 4; RING Finger Protein 51; PCGF4; RNF51) (PE); anti-BMI1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4E10-1C5
Specificity
Recognizes human BMI1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-BMI1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-326 from human BMI1 (AAH11652) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKASVNGSSATSSG
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (61.6kD).)

Western Blot (WB) (Western Blot detection against Immunogen (61.6kD).)

Western Blot (WB)

(PCGF4 monoclonal antibody, Western Blot analysis of PCGF4 expression in A-549.)

Western Blot (WB) (PCGF4 monoclonal antibody, Western Blot analysis of PCGF4 expression in A-549.)

Western Blot (WB)

(Western Blot analysis of PCGF4 expression in transfected 293T cell line by PCGF4 monoclonal antibody. Lane 1: PCGF4 transfected lysate (36.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PCGF4 expression in transfected 293T cell line by PCGF4 monoclonal antibody. Lane 1: PCGF4 transfected lysate (36.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-BMI1 antibody
Component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.
Product Categories/Family for anti-BMI1 antibody
References
1. Proteomics Analysis of Ring1B/Rnf2 Interactors Identifies a Novel Complex with the Fbxl10/Jhdm1B Histone Demethylase and the Bcl6 Interacting Corepressor. Sanchez C, Sanchez I, Demmers JA, Rodriguez P, Strouboulis J, Vidal M.Mol Cell Proteomics. 2007 May;6(5):820-34. Epub 2007 Feb 11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
648
Molecular Weight
36,949 Da
NCBI Official Full Name
Homo sapiens BMI1 polycomb ring finger oncogene, mRNA
NCBI Official Synonym Full Names
BMI1 proto-oncogene, polycomb ring finger
NCBI Official Symbol
BMI1
NCBI Official Synonym Symbols
PCGF4; RNF51; FLVI2/BMI1; flvi-2/bmi-1
NCBI Protein Information
polycomb complex protein BMI-1
Protein Family

NCBI Description

This gene encodes a ring finger protein that is major component of the polycomb group complex 1 (PRC1). This complex functions through chromatin remodeling as an essential epigenetic repressor of multiple regulatory genes involved in embryonic development and self-renewal in somatic stem cells. This protein also plays a central role in DNA damage repair. This gene is an oncogene and aberrant expression is associated with numerous cancers and is associated with resistance to certain chemotherapies. A pseudogene of this gene is found on chromosome X. Read-through transcription also exists between this gene and the upstream COMM domain containing 3 (COMMD3) gene. [provided by RefSeq, Sep 2015]

Research Articles on BMI1

Similar Products

Product Notes

The BMI1 (Catalog #AAA6156745) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BMI1 (Polycomb Complex Protein BMI-1, Polycomb Group RING Finger Protein 4, RING Finger Protein 51, PCGF4, RNF51) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BMI1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BMI1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BMI1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.